gpg2-2.4.4-150600.3.15.1<>, i{Z,p9|7U-äID8إM S "'E台ˠ_ZM <NKpu$9O>LN"*W2.;|.m SUˈv}*!118wHˢz` wov8J-3]+O@ qk2>a^ff8I`Resxv ٨,eY?0|o ʧtbg@E+TFJOZ+6 >F?d   dLP`d}  P{<{ 2{ ({ { "O{ #L{%8{'{**({,,D","/"(0:80D92H:< >BFG0{H{I{XYZ[\{]{^b-cdUeZf]l_ut{v`w{xp{y\<zL\`hptzCgpg22.4.4150600.3.15.1File encryption, decryption, signature creation and verification utilityGnuPG is a hybrid-encryption software program; it uses a combination of symmetric-key and public-key cryptography to encrypt/decrypt messages and/or to sign and verify them. gpg2 provides GPGSM, gpg-agent, and a keybox library.i{Z,ibs-power9-17SUSE Linux Enterprise 15SUSE LLC GPL-3.0-or-laterhttps://www.suse.com/Productivity/Networking/Securityhttps://www.gnupg.orglinuxppc64le [ -x /usr/bin/udevadm ] && /usr/bin/udevadm control --reload || : !   h  hS`H h %  ` H h x @  . p *4  )I.&F +4kt%6 > #5  @u o < o=EG& 81S1dY& ZFg-5&!5  ؠ#$3Z o8A큤AA큤A큤A큤A큤A큤i{Z!i{Z!i{Z$i{Z!i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z!i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z$i{Z i{Z$i{Z$i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z i{Z i{Z$i{Z(e2e3i{Z!i{Z!i{Z!i{Z!i{Z!i{Yi{Z!i{Z!i{Z!d+߷d+߷i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z(d+߷d+߷d+߷d+߷d+߷d+߷i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!i{Z%i{Z!i{Z!i{Z!i{Z!i{Z!i{Z%i{Z!i{Z!i{Z!i{Z!i{Z!i{Z!1174fdebb2a29b29bf003ea03a6ef0dbc9916b770a47bbc699e549323cddcd9c8aaba550fa0b2d7a26868ab2e37d3919eb08b51f4d19608970abe818471eb821ba2b1e8a3531b28ea294d0487cbdfd1a3cf7fd58d2151872f11b8990b50c839ce83652ec08b74cb8103425f4ba123c449028c4f3b93739702b36d7fa839ca38a245b1cc34edaf01ff6b6647d8af419cc58df1b60f8c9711b56ea1131f74731326a09547337e2a62c1b9603b0e688ea81024fa4de8934a69d3d186d2f80d478be809b4e86434efd1e85d60bdd5853ae3ca9604559ba9432267d418e4a165571aacad3eb4f87ba16c88de1aad140cbca21d41a4be56cb2705c9b8df32622441909aee654a33d3e59fdbf735eb382a116ec4781f622f3f2f2f6bfabec0e0f9700421e47ca38444fb35673fefc3d44d068c7f33ddb66d0d7ea6710dc6639645888d7ae59524d802e37bdf9a3a6ed7b8bef27689a9ca94f17866860cab00466a5cda3411645216eb5eba50546288bd1b442444dd22de0747eea50abea0c9cbe7cbeea5737b1ae52dcf718f083c29f7c85275721c8523f493c3314bdd53cfecaf5e3f4b0eb5685667e97969330ef75e3527d906ffcda114fe1b86c65eef8fadd795b9dab82b7be42047743724b64deaf82692946966aee6352b84bc2343c01afc5538395ed51fa86dcc0bc41c47db62d2899f9fc57fb2e4ad430673a4a1989272793fd9b3ac8d3b46555c186ac4de5829bf2ec4f9e51ba642d75710c4316c14153fe56cd33318c45901c1ac11cae82a9031e0bc8f65f93eb180defa0891b1e25f500c15c72515bc950071248e122e2c1aeeb4b5cf76f9fbaeb07e0dbce662024c830e731639fb4115b775e340989f30e7b55d2f416549226322c73c730eba51aed19d738414bde893748f87ff0ccc11b0e0d08b87867487ef25f1d0e85ee7458a77a35bfb86cfb339b93f1bad9e81ade975b78c6668219828e90463fa5afa977a59bdace6cefbfdc918dca407287363e3f3a260df701a1e7e4d6c4fe63fd76b66071f6c27e579c42106f3ab09191824cf4baea43a58b8f57ba3f0ae4a0058ae4783dd479721027b146a6399c15df7e0c795905d422a531bd6ff1cceb8cd47247f5dd0c894cfb7aaa5e75092ad738cd6b3cb1b2ac05c6082ae89071ef38d25558ba289ecea4b6b204d6b6701407c67ae1a1a8452e11593ea7f1e9805272f6c31c72521397fc8122e45a2cac3f1a7708ac30cf4256cd0f19258fa56a292c206e817881268ea489a57edb0db9394bf2d6c0ec62205f881bb54efb919e4870209c7db01aa75ed1ff1e351db978cfa581c6e11278e685099a8195cbe68a7754a4165a16998585ed2b83663b171562b65414383f077871289f9339c27a5e208fbfcc04c7e2c5f038f9525fa205e19477e31f57772981e87f85f7e2d84348ddadf49d3c67ba4bfd3dd5e998504628720e5047af75f2af198f016bc75ee5f8f6eabd735972cfe2d9a8c95acd0ac77d023c8f349d1939c6c2db7a1127fc7045494a87abc09db35fa186556537effdb6846a4eb6550f699359715a0babddee7102cb5caee3544a2d3662dbd7534139afe75239726b155a9942e142d567307932a61aa7b3d9c75a1651dfd51b4c955304ed6e2e7dc0c1973ef07ba2d38d6a3bd1308dbaefce249e36f98db9bce8147db0652809e7f6aade8185c5337a20f8a914e0b7e5a2f1d7d1383b5367b76118c5ca94a566f3dcbddf0672dc729251e7829f8e2f683f562f3e6b4fd642834c517d8335c4da74eb8ddb564ff4ecf4f70a83f4a1be2375ed8ef2cc2a196c18e82ef9c6e5b36c9f2290dbdaf5499e7d01aca6ef111d7f5c333e5d330afb303a16bbda4f35248f56d4657018de658fec8719f6aff96ef4c7dd723e2be83d5a52e0dd8d1c9690751c88056f28fffbbc004f2fea7b28bf4cea8471cf04cff471bc072551e715d4781790c1de28c31eeb5a8f611688f8812c3fc363d598ea441cf584f22765926aa3619387bd730fd2a5d7937ec3413372950c6bd43d85ea4762bca1c48e8cf3ff515d27b81a61e9083dc78a96ae0d27febe071ed40e9454385c2f6a5e8eefc5b89c42c85481f6faa27c975124ed315fcc522d614a945fdaa215a26149058730f3b4872176b993aaac3d4a3f3b71505de12cb048d1ca065c24442ba797c89825dbeec9b018146f326d4ee865d86de0270d94b3f1da12163ddcac775dfd2503deb17a3590eeacc7d59c57f6b646925626a1e89b987fd3dfea4efd381baf78ebdd75fca90b1213718355a50bc7dc2a2edd4d5140ca50b6487c1d7a1c780f015a46667cc06cd6355063c78c8fd5cfd57127d7937ab9c387657b104d9675b3332ef035c8f9daefa948b0fd262a07f017ab269bf67338be753e20d82de3dbb976a1f2f3a42bfab5136874a32508f55a4a2ebf2f462197f564e1267092aca5a090b4f4b824f856b07be5f8fa96fc4d5c1d9e0e4f6f93bc780ab89eef5fbda734e925a49adf801f9f5523595ded0a9b2abcb8026b5a7721313615bf3782730db603ef4bddba546330d7d69b211c22213adc6d3791e2a8802f35fedb9a70fce6bed52532b856323f4d4a6a47b7def90f83d145e5757c2ebf2c36ad8d89ec6367705a10152ba4f82a0e623851beeb031d097dd47e731f692bc03574abad0bbc97849bf71917ca59f579db0a7caea436f523ab592294b4ce80826c4b3eeea50fdd123a14d07b0df485cf390facfc1954b0ea82c8ae0d2c175393dff9d8b7ecd6463697591c771a71aaccdc3daac5c90325990fd491b2967396287895d75e4557580c0f681a5507ac7b3c0e64365f8ce6d5b37dc6221964631ac69c8a1d82ee51c2312bee314c62cf00faec6cb0ded2532f69a26ebfe5d1c543e472911c44b176a46cc16b4fbd200b42c6f9d93c054fec1ec9bb3750b3e44e0d464ef53adaabcc79f80967196849b5b5d765f8f165b82dff7fd53c93b61eb3596006fb2f941a1b6e5b5172fddc4ac62a112cb3d7981dbcbcc5de3f706084210e35d2659a2898d1358e4faef974ceb3c515b214fb63e1e30c9fc75d18b4dec1e6fb13506fba5ee88300f8599c18bacb0b5bbf6518c16c03b536e8ee12b832fe7bc72686bb6d9916028dd5a14e6ef45d5724ceac4906b1ed5275b6d49e9460006435afbc05cdf5a33891882a1b96e007c0ac8dc9f99592f3667f79d83904a38e38e8bbe29c51e8863bee4699fff0bce77ff5aad420daee802b30d92633705f509a93350219f78ea8e35f62879ca33af611fe0d2a9a1b46725cffd738b36d0bdfd91d332a4db9ff74cac6669ac2d0a67594dd0b3d1b8c89241b525d15157c34b636281f0033cfb574991ab8f1fc7d7d02e9cdb12c5e21138d825c09160d889d7ab8837c737cdd1ed155f65634a914da6ca944d358dffb35d4dc48aa5be9df5ef24011c46dbb32c6ec8118674435ed9ad970517b32a26af97e6e5bae1ebc5a957b0f2d8c7e9beb1162838ec98ef3306f751948f2d1c32dfe0628f44dac25fec8f5e7bb9555791b8baf61783141371fe91f859da848883f1763a6b3c2e662a23d5564a57c25bc2d6664f6276fa0a72d57633b3ae68dc7dcb677b71018bf08c8e93e509f1357ec4a7d97de212428cd53e09e0524616f0f584528e0698203fb4d71d6c55b48c58177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643d31a714a7ab67eb95ccae12b701e74fe307d771682f8792af7ed4e1ba33074a6b40f7806e14dd7aad5e0254c04c61bf1212de37296f1cd5782ffbc9e98cbee87909878b98dc2eaf3b07bbe1694ecd9f0523b7a621467c508d55daf28e0408be14d91b9a2794ec402565c80203ce8d90ead18a093dc672410a43c5f8cedff5d13860ce0e8e8a7b649b2e6666615c6ffa6cbf675a61ca2b9c61b130d693772742844efb273e509f4cd9c4ee397d6fdc697fd3b8e4da8e77dc5f25379919a9e47df587e71dd21fb0c052833960d10efe7e789c8772a5b5be0dcbc9e2967e8b934212fb4de21eaf05def70ab704f7f6b3da944cdd9c147dd5e9516f8563378a7ea40992560de50d821b8d4e0c84dc8eba5c1108e0f126c392da8191655b667e183ecc7462731fe1fad3e15c7943a5ae7338e91a27b61ab0cbe1f9c264200f8ac469fa6ec6fa76b51dce739279072f4c7ec37f5d8a43eef1b5f5d1817f92459612ceb26fe5226003918fe85f1a2ed44c048e4c97dd98a973002c79f265a906bbb7f188451a6c900ff8ca635b4af793149017390c25706cba4e2e873e414a4db9fb9341bf601be05516eda386e4697206dfbe7a11d6caed46f8d603860ee2ab82df264f2f18224b4b6a00593a6fad34fba27d763e221ac66262c79effa33e937beebdf2cbb13d005af79ed4c3d47b355258e9f780833603de54abdc4fedf6f2c75b9b2161f2bb4b15982da874561596dabce2dec80c3ba876b63122a645299669c1d5f8c1918b4a091109a2966f52a876e1e8d95c70bb81d3e5c03b5dcdfea34228a5be06def1cc8f26b0e60aa39b65f4a077c21b5b8479e2ff78b3c0cdef2085d385e4dc469063f80da0aba169a85e29e81e67452b18af7c8e24c586737686433dd05e88dc180cc81f74d59ece3a30d865840ac3dcce14e949b0a1591d826a302f514gpg2gpgv2help.sv.txthelp.sv.txthelp.sv.txthelp.sv.txthelp.sv.txthelp.sv.txthelp.sv.txthelp.sv.txthelp.sv.txtgpg2.1.gzgpgv2.1.gzrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootgpg2-2.4.4-150600.3.15.1.src.rpmconfig(gpg2)gnupggpggpg2gpg2(ppc-64)newpg@@@ @@@@@@@@@@ @@ @@@@@@@@    /bin/sh/bin/shconfig(gpg2)libassuan.so.0()(64bit)libassuan.so.0(LIBASSUAN_1.0)(64bit)libassuan0libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libc.so.6(GLIBC_2.32)(64bit)libc.so.6(GLIBC_2.33)(64bit)libc.so.6(GLIBC_2.34)(64bit)libc.so.6(GLIBC_2.38)(64bit)libgcrypt.so.20()(64bit)libgcrypt.so.20(GCRYPT_1.6)(64bit)libgcrypt20libgpg-errorlibgpg-error.so.0()(64bit)libgpg-error.so.0(GPG_ERROR_1.0)(64bit)libksbalibksba.so.8()(64bit)libksba.so.8(KSBA_0.9)(64bit)libnpth.so.0()(64bit)libnpth.so.0(NPTH_1.0)(64bit)libreadline.so.7()(64bit)libsqlite3.so.0()(64bit)libusb-1.0.so.0()(64bit)libz.so.1()(64bit)pinentryrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)2.4.4-150600.3.15.12.5.01.9.11.461.3.43.0.4-14.6.0-14.0-15.2-14.14.3iy@iy@i_@i_@i_@i_@i_@h]6@h>geM@e?e.w@e-%e%W@W@WWW]@W.@WWbWPW)@VV_V%@Vd#@Va@VTQ@VO @VU@U5@U'U@UU~@Uyx@UXUQ@U) U@U @TgTD@TMT@T~@TuTa@T[bangel.yankov@suse.comangel.yankov@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.comangel.yankov@suse.comangel.yankov@suse.compmonreal@suse.comlucas.mulling@suse.comlucas.mulling@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.compmonreal@suse.comdavid.anes@suse.compmonreal@suse.comandreas.stieger@gmx.deandreas.stieger@gmx.demeissner@suse.comandreas.stieger@gmx.deandreas.stieger@gmx.deandreas.stieger@gmx.depmonreal@suse.compmonreal@suse.comandreas.stieger@gmx.deandreas.stieger@gmx.deandreas.stieger@gmx.deandreas.stieger@gmx.deandreas.stieger@gmx.deandreas.stieger@gmx.deandreas.stieger@gmx.depmonrealgonzalez@suse.comandreas.stieger@gmx.depmonrealgonzalez@suse.comandreas.stieger@gmx.defvogt@suse.compmonrealgonzalez@suse.compmonrealgonzalez@suse.comandreas.stieger@gmx.depmonrealgonzalez@suse.comlnussel@suse.depmonrealgonzalez@suse.comjsikes@suse.depmonrealgonzalez@suse.comkbabioch@suse.dekbabioch@suse.depmonrealgonzalez@suse.comolaf@aepfle.dekbabioch@suse.deatoptsoglou@suse.comcrrodriguez@opensuse.orgkbabioch@suse.combwiedemann@suse.comkbabioch@suse.comtchvatal@suse.comastieger@suse.comkbabioch@suse.comastieger@suse.comkbabioch@suse.comkbabioch@suse.comastieger@suse.comfvogt@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.commarco.strigl@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comjengelh@inai.deastieger@suse.comtchvatal@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comtchvatal@suse.comastieger@suse.comastieger@suse.compjanouch@suse.deastieger@suse.comastieger@suse.comastieger@suse.comvcizek@suse.comp.drouand@gmail.comastieger@suse.comvcizek@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comastieger@suse.comschwab@linux-m68k.orgastieger@suse.comastieger@suse.commeissner@suse.comastieger@suse.comastieger@suse.comidonmez@suse.comastieger@suse.comastieger@suse.comastieger@suse.comandreas.stieger@gmx.dedev@stellardeath.organdreas.stieger@gmx.deandreas.stieger@gmx.devcizek@suse.comvcizek@suse.com- Security fix [bsc#1257396, CVE-2026-24882] - gpg2: stack-based buffer overflow in TPM2 PKDECRYPT for TPM-backed RSA and ECC keys - Added gnupg-CVE-2026-24882.patch- Security fix: [bsc#1256389] (gpg.fail/filename) * GnuPG Accepts Path Separators and Path Traversals in Literal Data "Filename" Field * Add gnupg-accepts-path-separators-literal-data.patch- Security fix: [bsc#1255715, CVE-2025-68973] (gpg.fail/memcpy) * gpg: Fix possible memory corruption in the armor parser [T7906] * Add gnupg-CVE-2025-68973.patch- Security fix: [bsc#1256246] (gpg.fail/sha1) * gpg: Avoid potential downgrade to SHA1 in 3rd party key signatures [T7904] * Add gnupg-gpg-Avoid-potential-downgrade-to-SHA1-in-3rd-party-keysig.patch- Security fix: [bsc#1256244] (gpg.fail/detached) * gpg: Error out on unverified output for non-detached signatures [T7903] * Add gnupg-gpg-Error-out-on-unverified-output-for-non-detached-signatures.patch- Security fix: [bsc#1256243] * gpg2 agent: Fix a memory leak * Add patch gnupg-agent-memleak.patch- Security fix: [bsc#1256390] (gpg.fail/notdash) * gpg2: Cleartext Signature Forgery in the NotDashEscaped header implementation in GnuPG * Add patch gnupg-notdash-escape.patch- Security fix: [bsc#1236931, bsc#1239119, CVE-2025-30258] * gpg: Fix regression for the recent malicious subkey DoS fix. * gpg: Fix another regression due to the T7547 fix. * gpg: Allow the use of an ADSK subkey as ADSK subkey. * Add patches: - gnupg-gpg-Fix-regression-for-the-recent-malicious-subkey-D.patch - gnupg-gpg-Fix-another-regression-due-to-the-T7547-fix.patch - gnupg-gpg-Allow-the-use-of-an-ADSK-subkey-as-ADSK-subkey.patch- Don't install expired sks certificate [bsc#1243069] * Add patch gnupg-dirmngr-Don-t-install-expired-sks-certificate.patch- Fix a verification DoS due to a malicious subkey in the keyring: [bsc#1239119] * Add patch gnupg-gpg-Fix-a-verification-DoS-due-to-a-malicious-subkey-in-the-keyring.patch- Update to 2.4.4: [bsc#1219191] * gpg: Do not keep an unprotected smartcard backup key on disk. See https://gnupg.org/blog/20240125-smartcard-backup-key.html for a security advisory. [T6944] * gpg: Allow to specify seconds since Epoch beyond 2038 on 32-bit platforms. [T6736] * gpg: Fix expiration time when Creation-Date is specified. [T5252] * gpg: Add support for Subkey-Expire-Date. [rG96b69c1866] * gpg: Add option --with-v5-fingerprint. [T6705] * gpg: Add sub-option ignore-attributes to --import-options. * gpg: Add --list-filter properties sig_expires/sig_expires_d. * gpg: Fix validity of re-imported keys. [T6399] * gpg: Report BEGIN_ status before examining the input. [T6481] * gpg: Don't try to compress a read-only keybox. [T6811] * gpg: Choose key from inserted card over a non-inserted card. [T6831] * gpg: Allow to create revocations even with non-compliant algos. [T6929] * gpg: Fix regression in the Revoker keyword of the parameter file. [T6923] * gpg: Improve error message for expired default keys. [T4704] * gpgsm: Add --always-trust feature. [T6559] * gpgsm: Support ECC certificates in de-vs mode. [T6802] * gpgsm: Major rewrite of the PKCS#12 parser. [T6536] * gpgsm: No not show the pkcs#12 passphrase in debug output. [T6654] * keyboxd: Timeout on failure to get the database lock. [T6838] * agent: Update the key stubs only if really modified. [T6829] * scd: Add support for certain Starcos 3.2 cards. [rG5304c9b080] * scd: Add support for CardOS 5.4 cards. [rG812f988059] * scd: Add support for D-Trust 4.1/4.4 cards. [rG0b85a9ac09] * scd: Add support for Smartcafe Expert 7.0 cards. [T6919] * scd: Add a length check for a new PIN. [T6843] * tpm: Fix keytotpm handling in the agent. [rG9909f622f6] * tpm: Fixes for the TPM test suite. [T6052] * dirmngr: New option --ignore-crl-extensions. [T6545] * dirmngr: Support config value "none" to disable the default keyserver. [T6708] * dirmngr: Fix handling of the HTTP Content-Length. [rGa5e33618f4] * gpgconf: Add commands --lock and --unlock. [rG93b5ba38dc] * gpgconf: Add keyword socketdir to gpgconf.ctl. [rG239c1fdc28] * gpgconf: Adjust the -X command for the new VERSION file format. [T6918] * wkd: Use export-clean for gpg-wks-client's --mirror and --create commands. [rG2c7f7a5a278c] * wkd: Make --add-revocs the default in gpg-wks-client. New option - -no-add-revocs. [rG10c937ee68] * Remove duplicated backslashes when setting the homedir. [T6833] * Ignore attempts to remove the /dev/null device. [T6556] * Improve advisory file lock retry strategy. [T3380] * Release-info: https://dev.gnupg.org/T6578 * Remove patch upstream: - gnupg-Report-BEGIN_-status-before-examining-the-input.patch- Fix the build in SLE and Leap by adding an exclude in the files section for the dirmngr's systemd user units. [jsc#PED-7093]- Do not pull revision info from GIT when autoconf is run. This removes the -unknown suffix after the version number. * Add gnupg-nobetasuffix.patch [bsc#1216334]- Fix Emacs EasyPG behavior when parsing output: * gpg: Report BEGIN_* status before examining the input. * Upstream task: https://dev.gnupg.org/T6481 * Add gnupg-Report-BEGIN_-status-before-examining-the-input.patch- Install the internal executables in the /usr/libexec dir instead of /usr/lib64. These files are keyboxd, scdaemon, gpg-auth gpg-check-pattern, gpg-pair-tool, gpg-preset-passphrase, gpg-protect-tool, gpg-wks-client, dirmngr_ldap and tpm2daemon.- Provide the systemd-user files since they have been removed upstream since version 2.4.1. [bsc#1201564] * Add gpg2-systemd-user.tar.xz- Install the systemd user units in the _userunitdir [bsc#1201564] * Note that, there is no activation by default. * Rework excludes in the spec's files section.- Revert back to use the IBM TPM Software stack.- Update to 2.4.3: * gpg: Set default expiration date to 3 years. [T2701] * gpg: Add --list-filter properties "key_expires" and "key_expires_d". [T6529] * gpg: Emit status line and proper diagnostics for write errors. [T6528] * gpg: Make progress work for large files on Windows. [T6534] * gpg: New option --no-compress as alias for -z0. * gpgsm: Print PROGRESS status lines. Add new --input-size-hint. [T6534] * gpgsm: Support SENDCERT_SKI for --call-dirmngr. [rG701a8b30f0] * gpgsm: Major rewrite of the PKCS#12 parser. [T6536] * gpgtar: New option --no-compress. * dirmngr: Extend the AD_QUERY command. [rG207c99567c] * dirmngr: Disable the HTTP redirect rewriting. [T6477] * dirmngr: New option --compatibility-flags. [rGbf04b07327] * dirmngr: New option --ignore-crl-extensions. [T6545] * wkd: Use export-clean for gpg-wks-client's --mirror and --create commands. [rG2c7f7a5a27] * wkd: Make --add-revocs the default in gpg-wks-client. New option - -no-add-revocs. [rG10c937ee68] * scd: Make signing work for Nexus cards. [rGb83d86b988] * scd: Fix authentication with Administration Key for PIV. [rG25b59cf6ce]- Update to 2.4.2: * gpg: Print a warning if no more encryption subkeys are left over after changing the expiration date. [rGef2c3d50fa] * gpg: Fix searching for the ADSK key when adding an ADSK. [T6504] * gpgsm: Speed up key listings on Windows. [rG08ff55bd44] * gpgsm: Reduce the number of "failed to open policy file" diagnostics. [rG68613a6a9d] * agent: Make updating of private key files more robust and track display S/N. [T6135] * keyboxd: Avoid longish delays on Windows when listing keys. [rG6944aefa3c] * gpgtar: Emit extra status lines to help GPGME. [T6497] * w32: Avoid using the VirtualStore. [T6403] * Rebase gnupg-add_legacy_FIPS_mode_option.patch- Update to 2.4.1: * If the ~/.gnupg directory does not exist, the keyboxd is now automagically enabled. [rGd9e7488b17] * gpg: New option --add-desig-revoker. [rG3d094e2bcf] * gpg: New option --assert-signer. [rGc9e95b8dee] * gpg: New command --quick-add-adsk and other ADSK features. [T6395, https://gnupg.org/blog/20230321-adsk.html] * gpg: New list-option "show-unusable-sigs". Also show "[self-signature]" instead of the user-id in key signature listings. [rG103acfe9ca] * gpg: For symmetric encryption the default S2K hash is now SHA256. [T6367] * gpg: Detect already compressed data also when using a pipe. Also detect JPEG and PNG file formats. [T6332] * gpg: New subcommand "openpgp" for --card-edit. [T6462] * gpgsm: Verification of detached signatures does now strip trailing zeroes from the input if --assume-binary is used. [rG2a13f7f9dc] * gpgsm: Non-armored detached signature are now created without using indefinite form length octets. This improves compatibility with some PDF signature verification software. [rG8996b0b655] * gpgtar: Emit progress status lines in create mode. [T6363] * dirmngr: The LDAP modifyTimestamp is now returned by some keyserver commands. [rG56d309133f] * ssh: Allow specification of the order keys are presented to ssh. See the man page entry for --enable-ssh-support. [T5996, T6212] * gpg: Make list-options "show-sig-subpackets" work again. Fixes regression in 2.4.0. [rG5a223303d7] * gpg: Fix the keytocard command for Yubikeys. [T6378] * gpg: Do not continue an export after a cancel for the primary key. [T6093] * gpg: Replace the --override-compliance-check hack by a real fix. [T5655] * gpgtar: Fix decryption with input taken from stdin. [T6355] * Rebase patches: - gnupg-revert-rfc4880bis.patch - gnupg-add_legacy_FIPS_mode_option.patch * Remove patch fixed upstream: - gnupg-tests-Fix-tests-gpgme-for-in-source-tree-builds.patch- Temporarily revert back to the pre-2.4 default for key generation. The new rfc4880bis has been set as the default in 2.4 version and might create incompatible keys. Note that, rfc4880bis can still be used with the option flag --rfc4880bis as in previous versions. * More info in the gnupg-devel ML: https://lists.gnupg.org/pipermail/gnupg-devel/2022-December/035183.html * Reverted commit https://dev.gnupg.org/rGcaf4b3fc16e9 * Add gnupg-revert-rfc4880bis.patch- Allow 8192 bit RSA keys in keygen UI when large_rsa is set * Add gnupg-allow-large-rsa.patch- Fix the regression test suite fails with the IBM TPM Software stack. Builds fine using the Intel TPM; use the swtpm and tpm2-0-tss-devel packages instead of ibmswtpm2 and ibmtss-devel.- Fix broken GPGME QT tests: Upstram dev task dev.gnupg.org/T6313 * The original patch has been modified to expand the changes also to the tests/gpgme/Makefile.in file. * Add gnupg-tests-Fix-tests-gpgme-for-in-source-tree-builds.patch- Updated to require libgpg-error-devel >= 1.46 - Rebased patches: * gnupg-allow-import-of-previously-known-keys-even-without-UIDs.patch * gnupg-add_legacy_FIPS_mode_option.patch - GnuPG 2.4.0: * common: Fix translations in --help for gpgrt < 1.47. * gpg: Do not continue the export after a cancel for the primary key. * gpg: Replace use of PRIu64 in log_debug. * Update NEWS for 2.4.0. * tests: Fix make check with GPGME. * agent: Allow arguments to "scd serialno" in restricted mode. * scd:p15: Skip deleted records. * build: Remove Windows CE support. * wkd: Do not send/install/mirror expired user ids. * gpgsm: Print the revocation time also with --verify. * gpgsm: Fix "problem re-searching certificate" case. * gpgsm: Print revocation date and reason in cert listings. * gpgsm: Silence the "non-critical certificate policy not allowed". * gpgsm: Always use the chain model if the root-CA requests this. * gpg: New export option "mode1003". * gpg: Remove a mostly duplicated function. * tests: Simplify fake-pinentry to use the option only. * tests: Fix fake-pinentry for Windows. * tests: Fix make check-all. * agent: Fix import of protected v5 keys. * gpgsm: Change default algo to AES-256. * tests: Put a workaround for semihosted environment. * tests: More fix for semihosted environment. * tests: Support semihosted environment. * tests: Fix tests under cms. * tests,w32: Fix for semihosted environment. * w32: Fix for tests on semihosted environment. * w32: Fix gnupg_unsetenv. * wkd: New option --add-revocs and some fixes. * wkd: Make use of --debug extprog. * gpg: New export-filter export-revocs. * gpg: Fix double-free in gpg --card-edit. * gpg: Make --require-compliance work with out --status-fd. * gpg: New option --list-filter. * dirmngr: Silence ocsp debug output. * tests: Fix to support --enable-all-tests and variants. * tests:w32: Fix for non-dot file name for Windows. * tests:gpgscm:w32: Fix for GetTempPath. * tests: Keep .log files in objdir. * tests: Use 233 for invalid value of FD. * w32: Fix gnupg_tmpfile for possible failure. * scd: Redact --debug cardio output of a VERIFY APDU. * common: Remove Windows CE support in common. * gpgsm: Fix colon outout of ECC encryption certificates. * scd:nks: Fix ECC signing if key not given by keygrip. * dirmngr: Fix verification of ECDSA signed CRLs. * agent: Allow trustlist on Windows in Unicode homedirs. * gpg: Fix verification of cleartext signatures with overlong lines. * gpg: Move w32_system function. * gpg: New option --quick-update-pref. * gpg: New list-options show-pref and show-pref-verbose. * tests: Add tests to check that OCB is only used for capable keys. * gpg: Make --list-packets work w/o --no-armor for plain OCB packets. * tests: Add symmetric decryption tests. * tests: Add tr:assert-same function. * agent: Avoid blanks in the ssh key's comment. * build: Update m4 files. * gpg: Merge --rfc4880bis features into --gnupg. * gpg: Allow only OCB for AEAD encryption. * gpg: New option --compatibility-flags. * gpgsm: Also announce AES256-CBC in signatures. * gpg: Fix trusted introducer for user-ids with only the mbox. * gpg: Import stray revocation certificates. * agent: Automatically convert to extended key format by KEYATTR. * card: New commands "gpg" and "gpgsm". * card: Also show fingerprints of known X.509 certificates. * scd:nks: Support non-ESIGN signing with the Signature Card v2. * gpgsm: Allow ECC encryption keys with just keyAgreement specified. * gpgsm: Use macro constants for cert_usage_p. * build: Update gpg-error.m4. * agent,common,dirmngr,tests,tools: Remove spawn PREEXEC argument. * gpg: Move NETLIBS after GPG_ERROR_LIBS. * gpg: Use GCRY_KDF_ONESTEP_KDF with newer libgcrypt in future. * common,w32: Fix struct stat on Windows. * agent,w32: Support Win32-OpenSSH emulation by gpg-agent. * common: Don't use FD2INT for POSIX-only code. * dirmngr: Fix build with no LDAP support.- GnuPG 2.3.8: * gpg: Do not consider unknown public keys as non-compliant while decrypting. * gpg: Avoid to emit a compliance mode line if Libgcrypt is non-compliant. * gpg: Improve --edit-key setpref command to ease c+p. * gpg: Emit an ERROR status if --quick-set-primary-uid fails and allow to pass the user ID by hash. * gpg: Actually show symmetric+pubkey encrypted data as de-vs compliant. Add extra compliance checks for symkey_enc packets. * gpg: In de-vs mode use SHA-256 instead of SHA-1 as implicit preference. * gpgsm: Fix reporting of bad passphrase error during PKCS#11 import. * agent: Fix a regression in "READKEY --format=ssh". * agent: New option --need-attr for KEYINFO. * agent: New attribute "Remote-list" for use by KEYINFO. * scd: Fix problem with Yubikey 5.4 firmware. * dirmngr: Fix CRL Distribution Point fallback to other schemes. * dirmngr: New LDAP server flag "areconly" (A-record-only). * dirmngr: Fix upload of multiple keys for an LDAP server specified using the colon format. * dirmngr: Use LDAP schema v2 when a Base DN is specified. * dirmngr: Avoid caching expired certificates. * wkd: Fix path traversal attack in gpg-wks-server. Add the mail address to the pending request data. * wkd: New command --mirror for gpg-wks-client. * gpg-auth: New tool for authentication. * New common.conf option no-autostart. * Silence warnings from AllowSetForegroundWindow unless GNUPG_EXEC_DEBUG_FLAGS is used. * Rebase gnupg-detect_FIPS_mode.patch * Remove patch upstream: - gnupg-2.3.7-scd-openpgp-Fix-workaround-for-Yubikey-heuristics.patch- Fix YubiKey 5 Nano support (boo#1202201), add gnupg-2.3.7-scd-openpgp-Fix-workaround-for-Yubikey-heuristics.patch- GnuPG 2.3.7: * CVE-2022-34903: garbled status messages could trick gpgme and other parsers to accept faked status lines [boo#1201225] * A number of bug fixes to the gpg command line interface * gpgsm gained a number of new options and got some rework on the PKCS#12 parser to support DFN issues keys * The gpg agent got some added options and UI tweaks * smart card support got a number of bug fixes, and improved support for Technology Nexus cards and Yubikey * The Telesec ESIGN application is now supported- added tpm support, added a new subpackage gpg2-tpm- GnuPG 2.3.6: * Up to five times faster verification of detached signatures, doubled detached signing speed, threefold decryption speedup for large files, nearly double the AES256.OCB encryption speed * Add support for GeNUA cards * Added and improved options for crypto options, and all-around bug fixes- GnuPG 2.3.4: * gpg: New option --min-rsa-length * gpg: New option --forbid-gen-key * gpg: New option --override-compliance-check * gpgconf: New command --show-configs * agent,dirmngr,keyboxd: New option --steal-socket * gpg: Fix printing of binary notations * gpg: Remove stale ultimately trusted keys from the trustdb * gpg: Fix indentation of --print-mds and --print-md sha512 * gpg: Emit gpg 2.2 compatible Ed25519 signature * gpgsm: Detect circular chains in --list-chain * dirmngr: Make reading resolv.conf more robust * dirmngr: Ask keyservers to provide the key fingerprints * gpgconf: Allow changing gpg's deprecated keyserver option * gpg-wks-server: Fix created file permissions * scd: Support longer data for ssh-agent authentication with openpgp cards * scd: Modify DEVINFO behavior to support looping forever * Silence warning about the rootdir under Unices w/o a mounted /proc file system * Fix possible build problems about missing include files- GnuPG 2.3.3: * agent: Fix segv in GET_PASSPHRASE (regression) * dirmngr: Fix Let's Encrypt certificate chain validation * gpg: Change default and maximum AEAD chunk size to 4 MiB * gpg: Print a warning when importing a bad cv25519 secret key * gpg: Fix --list-packets for undecryptable AEAD packets * gpg: Verify backsigs for v5 keys correctly * keyboxd: Fix checksum computation for no UBID entry on disk * keyboxd: Fix "invalid object" error with cv448 keys * dirmngr: New option --ignore-cert * agent: Fix calibrate_get_time use of clock_gettime * Support a gpgconf.ctl file under Unix and use this for the regression tests- GnuPG 2.3.2: * gpg: Allow fingerprint based lookup with --locate-external-key. * gpg: Allow decryption w/o public key but with correct card inserted. * gpg: Auto import keys specified with --trusted-keys. * gpg: Do not use import-clean for LDAP keyserver imports. * gpg: Fix mailbox based search via AKL keyserver method. * gpg: Fix memory corruption with --clearsign introduced with 2.3.1. * gpg: Use a more descriptive prompt for symmetric decryption. * gpg: Improve speed of secret key listing. * gpg: Support keygrip search with traditional keyring. * gpg: Let --fetch-key return an exit code on failure. * gpg: Emit the NO_SECKEY status again for decryption. * gpgsm: Support decryption of password based encryption (pwri). * gpgsm: Support AES-GCM decryption. * gpgsm: Let --dump-cert --show-cert also print an OpenPGP fingerprint. * gpgsm: Fix finding of issuer in use-keyboxd mode. * gpgsm: New option --ldapserver as an alias for --keyserver. * agent: Use SHA-256 for SSH fingerprint by default. * agent: Fix calling handle_pincache_put. * agent: Fix importing protected secret key. * agent: Fix a regression in agent_get_shadow_info_type. * agent: Add translatable text for Caps Lock hint. * agent: New option --pinentry-formatted-passphrase. * agent: Add checkpin inquiry for pinentry. * agent: New option --check-sym-passphrase-pattern. * agent: Use the sysconfdir for a pattern file. * agent: Make QT_QPA_PLATFORMTHEME=qt5ct work for the pinentry. * dirmngr: LDAP search by a mailbox now ignores revoked keys. * dirmngr: For KS_SEARCH return the fingerprint also with LDAP. * dirmngr: Allow for non-URL specified ldap keyservers. * dirmngr: New option --ldapserver. * dirmngr: Fix regression in KS_GET for mail address pattern. * card: New option --shadow for the list command. * tests: Make sure the built keyboxd is used. * scd: Fix computing shared secrets for 512 bit curves. * scd: Fix unblock PIN by a Reset Code with KDF. * scd: Fix PC/SC removed card problem. * scd: Recover the partial match for PORTSTR for PC/SC. * scd: Make sure to release the PC/SC context. * scd: Fix zero-byte handling in ECC. * scd: Fix serial number detection for Yubikey 5. * scd: Add basic support for AET JCOP cards. * scd: Detect external interference when --pcsc-shared is in use. * scd: Fix access to the list of cards. * gpgconf: Do not list a disabled tpm2d. * gpgconf: Make runtime changes with different homedir work. * keyboxd: Fix searching for exact mail adddress. * keyboxd: Fix searching with multiple patterns. * tools: Extend gpg-check-pattern. * wkd: Fix client issue with leading or trailing spaces in user-ids. * Pass XDG_SESSION_TYPE and QT_QPA_PLATFORM envvars to Pinentry. * Change the default keyserver to keyserver.ubuntu.com. This is a temporary change due to the shutdown of the SKS keyserver pools.- GnuPG 2.3.1: * The new configuration file common.conf is now used to enable the use of the key database daemon with "use-keyboxd". Using this option in gpg.conf and gpgsm.conf is supported for a transitional period. See doc/example/common.conf for more. * gpg: Force version 5 key creation for ed448 and cv448 algorithms. * gpg: By default do not use the self-sigs-only option when importing from an LDAP keyserver. * gpg: Lookup a missing public key of the active card via LDAP. * gpgsm: New command --show-certs. * scd: Fix CCID driver for SCM SPR332/SPR532. * scd: Further improvements for PKCS#15 cards. * New configure option --with-tss to allow the selection of the TSS library. - Rebase patches: * gnupg-add_legacy_FIPS_mode_option.patch * gnupg-allow-import-of-previously-known-keys-even-without-UIDs.patch * gnupg-dont-fail-with-seahorse-agent.patch * gnupg-set_umask_before_open_outfile.patch- GnuPG 2.3.0: * A new experimental key database daemon is provided. To enable it put "use-keyboxd" into gpg.conf and gpgsm.conf. Keys are stored in a SQLite database and make key lookup much faster. * New tool gpg-card as a flexible frontend for all types of supported smartcards. * New option --chuid for gpg, gpgsm, gpgconf, gpg-card, and gpg-connect-agent. * The gpg-wks-client tool is now installed under bin; a wrapper for its old location at libexec is also installed. * tpm2d: New daemon to physically bind keys to the local machine. * gpg: Switch to ed25519/cv25519 as default public key algorithms. * gpg: Verification results now depend on the --sender option and the signer's UID subpacket. * gpg: Do not use any 64-bit block size cipher algorithm for encryption. Use AES as last resort cipher preference instead of 3DES. This can be reverted using --allow-old-cipher-algos. * gpg: Support AEAD encryption mode using OCB or EAX. * gpg: Support v5 keys and signatures. * gpg: Support curve X448 (ed448, cv448). * gpg: Allow use of group names in key listings. * gpg: New option --full-timestrings to print date and time. * gpg: New option --force-sign-key. * gpg: New option --no-auto-trust-new-key. * gpg: The legacy key discovery method PKA is no longer supported. The command --print-pka-records and the PKA related import and export options have been removed. * gpg: Support export of Ed448 Secure Shell keys. * gpgsm: Add basic ECC support. * gpgsm: Support creation of EdDSA certificates. [#4888] * agent: Allow the use of "Label:" in a key file to customize the pinentry prompt. * agent: Support ssh-agent extensions for environment variables. With a patched version of OpenSSH this avoids the need for the "updatestartuptty" kludge. * scd: Improve support for multiple card readers and tokens. * scd: Support PIV cards. * scd: Support for Rohde&Schwarz Cybersecurity cards. * scd: Support Telesec Signature Cards v2.0 * scd: Support multiple application on certain smartcard. * scd: New option --application-priority. * scd: New option --pcsc-shared; see man page for important notes. * dirmngr: Support a gpgNtds parameter in LDAP keyserver URLs. * The symcryptrun tool, a wrapper for the now obsolete external Chiasmus tool, has been removed. * Full Unicode support for the command line. - dropped legacy commands: gpg-zip- Remove the "files-are-digests" option from the openSUSE package. This feature was not upstream and only used in the OBS signing daemon. The recommended upstream feature for separating the data to be signed from the private keys is gpg agent forwarding, available from 2.1. Drop gnupg-2.2.8-files-are-digests.patch- GnuPG 2.2.27: * gpgconf: Fix case with neither local nor global gpg.conf * gpgconf: Fix description of two new options - includes changes from 2.2.26: * gpg: New AKL method "ntds" * gpg: Fix --trusted-key with fingerprint arg * scd: Fix writing of ECC keys to an OpenPGP card * scd: Make an USB error fix specific to SPR532 readers * dirmngr: With new LDAP keyservers store the new attributes. Never store the useless pgpSignerID. Fix a long standing bug storing some keys on an ldap server. * dirmngr: Support the new Active Direcory LDAP schema for keyservers * dirmngr: Allow LDAP OpenPGP searches via fingerprint * dirmngr: Do not block other threads during keyserver LDAP calls * Support global configuration files * Fix the iconv fallback handling to UTF-8- GnuPG 2.2.25: * scd: Fix regression in 2.2.24 requiring gpg --card-status before signing or decrypting * gpgsm: Using Libksba 1.5.0 signatures with a rarely used combination of attributes can now be verified- GnuPG 2.2.24: * gpg: New command --quick-revoke-sig * gpg: Do not use weak digest algos if selected by recipient preference during sign+encrypt * gpg: Switch to AES256 for symmetric encryption in de-vs mode * gpg: Silence weak digest warnings with --quiet * gpg: Print new status line CANCELED_BY_USER for a cancel during symmetric encryption * gpg: Fix the encrypt+sign hash algo preference selection for ECDSA. This is in particular needed for keys created from existing smartcard based keys * agent: Fix secret key import of GnuPG 2.3 generated Ed25519 keys * agent: Keep some permissions of private-keys-v1.d * dirmngr: Align sks-keyservers.netCA.pem use between ntbtls and gnutls builds * dirmngr: Fix the pool keyserver case for a single host in the pool * scd: Fix the use case of verify_chv2 by CHECKPIN * scd: Various improvements to the ccid-driver * scd: Minor fixes for Yubikey * gpgconf: New option --show-versions * i18n: Complete overhaul and completion of the Italian translation- GnuPG 2.2.23: * gpg: fix AHEAD preference list overflow boo#1176034 / CVE-2020-25125 * gpg: fix possible segv in the key cleaning code * gpgsm: fix a minor RFC2253 parser gub * scdaemon: Fix a PIN verify failure on certain OpenPGP card implementations- GnuPG 2.2.22: * gpg: Change the default key algorithm to rsa3072 * gpg: Add regular expression support for Trust Signatures on all platforms * gpg: Ignore --personal-digest-prefs for ECDSA keys * gpgsm: Make rsaPSS a de-vs compliant scheme * gpgsm: Show also the SHA256 fingerprint in key listings * gpgsm: Do not require a default keyring for --gpgconf-list * gpg-agent: Default to extended key format and record the creation time of keys Add new option --disable-extended-key-format * gpg-agent: Support the WAYLAND_DISPLAY envvar * gpg-agent: Allow using --gpgconf-list even if HOME does not exist * gpg-agent: Make the Pinentry work even if the envvar TERM is set to the empty string * scdaemon: Add a workaround for Gnuk tokens <= 2.15 which wrongly incremented the error counter when using the "verify" command of "gpg --edit-key" with only the signature key being present * dirmngr: Better handle systems with disabled IPv6 * gpgpslit: Install tool. It was not installed in the past to avoid conflicts with the version installed by GnuPG 1.4 * gpgtar: Make --files-from and --null work as documented - drop gnupg-gpgme-t-encrypt-sym.patch, upstream- Fix regression in latest gpg2 that makes gpgme fail to build [bsc#1174007] - Add gnupg-gpgme-t-encrypt-sym.patch- GnuPG 2.2.21: * gpg: Improve symmetric decryption speed by about 25% * gpg: Support decryption of AEAD encrypted data packets * gpg: Add option --no-include-key-block * gpg: Allow for extra padding in ECDH * gpg: Only a single pinentry is shown for symmetric encryption if the pinentry supports this * gpg: Print a note if no keys are given to --delete-key * gpg,gpgsm: The ridiculous passphrase quality bar is not anymore shown * gpgsm: Certificates without a CRL distribution point are now considered valid without looking up a CRL. The new option - -enable-issuer-based-crl-check can be used to revert to the former behaviour * gpgsm: Support rsaPSS signature verification * gpgsm: Unless CRL checking is disabled lookup a missing issuer certificate using the certificate's authorityInfoAccess * gpgsm: Print the certificate's serial number also in decimal notation * gpgsm: Fix possible NULL-deref in messages of --gen-key * scd: Support the CardOS 5 based D-Trust Card 3.1 * dirmngr: Allow http URLs with "LOOKUP --url" * wkd: Take name of sendmail from configure. Fixes an OpenBSD specific bug- Fix gpgme and gpgme-qt builds on gpg2 2.2.20 update [bsc#1170811] - Refresh patches: * gnupg-2.2.8-files-are-digests.patch * gnupg-add_legacy_FIPS_mode_option.patch- GnuPG 2.2.20: * Protect the error counter against overflow to guarantee that the tools can't be tricked into returning success after an error * gpg: Make really sure that --verify-files always returns an error * gpg: Fix key listing --with-secret if a pattern is given * gpg: Fix detection of certain keys used as default-key * gpg: Fix default-key selection when a card is available * gpg: Fix key expiration and key usage for keys created with a creation date of zero * gpgsm: Fix import of some CR,LF terminated certificates * gpg: New options --include-key-block and --auto-key-import to allow encrypted replies after an initial signed message * gpg: Allow the use of a fingerprint with --trusted-key * gpg: New property "fpr" for use by --export-filter * scdaemon: Disable the pinpad if a KDF DO is used * dirmngr: Improve finding OCSP certificates - drop gpg2-gcc10-build-fno-common.patch, upstream- Split dirmngr into a subpackage to avoid a hard dependency of gpg2 on libgnutls- Fix build with GCC-10: [bsc#1160394] * Always use EXTERN_UNLESS_MAIN_MODULE pattern * In GCC-10, the default option -fcommon will change to -fno-common - Add gpg2-gcc10-build-fno-common.patch- Accept key updates even without UIDs [bsc#1143158] - Add patches: * gnupg-allow-import-of-previously-known-keys-even-without-UIDs.patch * gnupg-accept_subkeys_with_a_good_revocation_but_no_self-sig_during_import.patch * gnupg-add-test-cases-for-import-without-uid.patch- update to 2.2.19: * gpg: Fix double free when decrypting for hidden recipients * gpg: Use auto-key-locate for encryption even for mail addressed given with angle brackets * gpgsm: Add special case for certain expired intermediate certificates- Update to 2.2.18 [bsc#1157900, CVE-2019-14855] * gpg: Changed the way keys are detected on a smartcards; this allows the use of non-OpenPGP cards. In the case of a not very likely regression the new option --use-only-openpgp-card is available. [#4681] * gpg: The commands --full-gen-key and --quick-gen-key now allow direct key generation from supported cards. [#4681] * gpg: Prepare against chosen-prefix SHA-1 collisions in key signatures. This change removes all SHA-1 based key signature newer than 2019-01-19 from the web-of-trust. Note that this includes all key signature created with dsa1024 keys. The new option --allow-weak-key-signatues can be used to override the new and safer behaviour. [#4755,CVE-2019-14855] * gpg: Improve performance for import of large keyblocks. [#4592] * gpg: Implement a keybox compression run. [#4644] * gpg: Show warnings from dirmngr about redirect and certificate problems (details require --verbose as usual). * gpg: Allow to pass the empty string for the passphrase if the '--passphase=' syntax is used. [#4633] * gpg: Fix printing of the KDF object attributes. * gpg: Avoid surprises with --locate-external-key and certain - -auto-key-locate settings. [#4662] * gpg: Improve selection of best matching key. [#4713] * gpg: Delete key binding signature when deletring a subkey. [#4665,#4457] * gpg: Fix a potential loss of key sigantures during import with self-sigs-only active. [#4628] * gpg: Silence "marked as ultimately trusted" diagnostics if option --quiet is used. [#4634] * gpg: Silence some diagnostics during in key listsing even with option --verbose. [#4627] * gpg, gpgsm: Change parsing of agent's pkdecrypt results. [#4652] * gpgsm: Support AES-256 keys. * gpgsm: Fix a bug in triggering a keybox compression run if - -faked-system-time is used. * dirmngr: System CA certificates are no longer used for the SKS pool if GNUTLS instead of NTBTLS is used as TLS library. [#4594] * dirmngr: On Windows detect usability of IPv4 and IPv6 interfaces to avoid long timeouts. [#4165] * scd: Fix BWI value for APDU level transfers to make Gemalto Ezio Shield and Trustica Cryptoucan work. [#4654,#4566] * wkd: gpg-wks-client --install-key now installs the required policy file. - Rebase patches: * gnupg-2.2.8-files-are-digests.patch * gnupg-add_legacy_FIPS_mode_option.patch- Do not recommend lang package. The lang package already has a supplements.- Update to 2.2.17 [bsc#1141093] * gpg: Do not try the import fallback if the options are already used. * gpg: Fix regression in option "self-sigs-only". * gpg: With --auto-key-retrieve prefer WKD over keyservers. * gpg: Add "self-sigs-only" and "import-clean" to the keyserver options. * gpg: Avoid printing false AKL error message. * gpg: New command --locate-external-key. * gpg: Make the get_pubkey_byname interface easier to understand. * gpg: Fallback to import with self-sigs-only on too large keyblocks. * gpg: New import and keyserver option "self-sigs-only" * gpg: Make read_block in import.c more flexible. * dirmngr: fix handling of HTTPS redirections during HKP. * dirmngr: Avoid endless loop in case of HTTP error 503. * dirmngr: Do not rewrite the redirection for the "openpgpkey" subdomain. * dirmngr: Support the new WKD draft with the openpgpkey subdomain. * wkd: Change client/server limit back to 64 KiB. * tools: gpgconf: Killing order is children-first. * Return better error code for some getinfo IPC commands. * po: Update Russian translation.- Fix secure memory being disabled before fips checks in libgcrypt [boo#1137307] * Added gnupg-2.2.16-secmem.patch- Update to 2.2.16 * gpg: Fixed i18n markup of some strings. * gpg: Allow deletion of subkeys with --delete-[secret-]key. * gpg: Do not bail on an invalid packet in the local keyring. * gpg: Do not allow creation of user ids larger than our parser allows. * gpg: Do not delete any keys if --dry-run is passed. * gpg: Fix using --decrypt along with --use-embedded-filename. * gpg: Improve the photo image viewer selection. * gpg: enable OpenPGP export of cleartext keys with comments. * gpg: Do not print a hint to use the deprecated --keyserver option. * gpg: Change update_keysig_packet to replace SHA-1 by SHA-256. * gpg: Use just the addrspec from the Signer's UID. * gpg: Accept also armored data from the WKD. * gpg: Set a limit of 5 to the number of keys imported from the WKD. * gpg: Don't use EdDSA algo ID for ECDSA curves. * agent: Stop scdaemon after reload when disable_scdaemon. * agent: For SSH key, don't put NUL-byte at the end. * agent: correct length for uri and comment on 64-bit big-endian platforms * dirmngr: Allow for other hash algorithms than SHA-1 in OCSP. * dirmngr: Improve domaininfo cache update algorithm. * dirmngr: Better error code for http status 413. * g10: Fix possible null dereference. * g10: Fix double free when locating by mbox. * g10: Fix symmetric cipher algo constant for ECDH. * sm: Avoid confusing diagnostic for the default key. * sm: Fix a warning in an es_fopencooie function. * gpgconf: Before --launch check that the config file is fine. * gpgconf: Support --homedir for --launch. * build: Update m4/iconv.m4. * doc: correct documentation for gpgconf --kill. * scd: Add dummy option --application-priority. * common: Fix AWK portability.- Update to 2.2.15 * sm: Allow decryption even if expired keys are configured. * agent: Change command KEYINFO to print ssh fingerprints with other hash algos. * dirmngr: Fix build problems on Solaris due to the use of reserved symbol names. * wkd: New commands --print-wkd-hash and --print-wkd-url for gpg-wks-client.- Update to 2.2.14: * gpg: Allow import of PGP desktop exported secret keys. Also avoid importing secret keys if the secret keyblock is not valid. * gpg: Do not error out on version 5 keys in the local keyring. * gpg: Make invalid primary key algo obvious in key listings. * sm: Do not mark a certificate in a key listing as de-vs compliant if its use for a signature will not be possible. * sm: Fix certificate creation with key on card. * sm: Create rsa3072 bit certificates by default. * sm: Print Yubikey attestation extensions with --dump-cert. * agent: Fix cancellation handling for scdaemon. * agent: Support --mode=ssh option for CLEAR_PASSPHRASE. * scd: Fix flushing of the CA-FPR DOs in app-openpgp. * scd: Avoid a conflict error with the "undefined" app. * dirmngr: Add CSRF protection exception for protonmail. * dirmngr: Fix build problems with gcc 9 in libdns. * gpgconf: New option --show-socket for use wity --launch. * gpgtar: Make option -C work for archive creation. - Removed patches that are included upstream by now: - 0001-libdns-Avoid-using-compound-literals.patch - 0002-libdns-Avoid-using-compound-literals-2.patch - 0003-libdns-Avoid-using-compound-literals-3.patch - 0004-libdns-Avoid-using-compound-literals-4.patch - 0005-libdns-Avoid-using-compound-literals-5.patch - 0006-libdns-Avoid-using-compound-literals-6.patch - 0007-libdns-Avoid-using-compound-literals-7.patch - 0008-libdns-Avoid-using-compound-literals-8.patch- Fix build with gcc9 [bsc#1121223] * Avoid using compound literals - Upstream bug: https://dev.gnupg.org/T4367 * Added upstream patches: - 0001-libdns-Avoid-using-compound-literals.patch - 0002-libdns-Avoid-using-compound-literals-2.patch - 0003-libdns-Avoid-using-compound-literals-3.patch - 0004-libdns-Avoid-using-compound-literals-4.patch - 0005-libdns-Avoid-using-compound-literals-5.patch - 0006-libdns-Avoid-using-compound-literals-6.patch - 0007-libdns-Avoid-using-compound-literals-7.patch - 0008-libdns-Avoid-using-compound-literals-8.patch- Allow coredumps in X11 desktop sessions (bsc#1124847) gpg-agent unconditionally disables coredumps, which is not supposed to happen in the code path that does just exec(argv[]) gnupg-gpg-agent-ulimit.patch- Update to 2.2.13: * gpg: Implement key lookup via keygrip (using the & prefix). * gpg: Allow generating Ed25519 key from existing key. * gpg: Emit an ERROR status line if no key was found with -k. * gpg: Stop early when trying to create a primary Elgamal key. * gpgsm: Print the card's key algorithms along with their keygrips in interactive key generation. * agent: Clear bogus pinentry cache in the error case. * scd: Support "acknowledge button" feature. * scd: Fix for USB INTERRUPT transfer. * wks: Do no use compression for the the encrypted challenge and response. Release-info: https://dev.gnupg.org/T4290 See-also: gnupg-announce/2019q1/000434.html- Update to 2.2.12: * tools: New commands --install-key and --remove-key for gpg-wks-client. This allows to prepare a Web Key Directory on a local file system for later upload to a web server. * gpg: New --list-option "show-only-fpr-mbox". This makes the use of the new gpg-wks-client --install-key command easier on Windows. * gpg: Improve processing speed when --skip-verify is used. * gpg: Fix a bug where a LF was accidentally written to the console. * gpg: --card-status now shwos whether a card has the new KDF feature enabled. * agent: New runtime option --s2k-calibration=MSEC. New configure option --with-agent-s2k-calibration=MSEC. [#3399] * dirmngr: Try another keyserver from the pool on receiving a 502, 503, or 504 error. [#4175] * dirmngr: Avoid possible CSRF attacks via http redirects. A HTTP query will not anymore follow a 3xx redirect unless the Location header gives the same host. If the host is different only the host and port is taken from the Location header and the original path and query parts are kept. * dirmngr: New command FLUSHCRL to flush all CRLS from disk and memory. [#3967]- Code no longer uses libcurl, remove from buildrequires.- Update to 2.2.11: * gpgsm: Fix CRL loading when intermediate certicates are not yet trusted. * gpgsm: Fix an error message about the digest algo. * gpg: Fix a wrong warning due to new sign usage check introduced with 2.2.9. * gpg: Print the "data source" even for an unsuccessful keyserver query. * gpg: Do not store the TOFU trust model in the trustdb. * scd: Fix cases of "Bad PIN" after using "forcesig". * agent: Fix possible hang in the ssh handler. * dirmngr: Tack the unmodified mail address to a WKD request. * dirmngr: Tweak diagnostic about missing LDAP server file. * dirmngr: In verbose mode print the OCSP responder id. * dirmngr: Fix parsing of the LDAP port. * wks: Add option --directory/-C to the server. * wks: Add option --with-colons to the client. * Fix EBADF when gpg et al. are called by broken CGI scripts. * Fix some minor memory leaks and bugs.- Make package build reproducible (boo#1047218)- Update to 2.2.10: * Refresh expired keys originating from the WKD * Use a 256 KiB limit for a WKD imported key * New option --known-notation * dirmngr: Validate SRV records in WKD queries- Add basic udev rules for smartcards to be used with scdaemon, taken from debian: * scdaemon.udev- GnuPG 2.2.9: * dirmngr: Fix recursive resolver mode and other bugs in the libdns code * dirmngr: When using libgpg-error 1.32 or later a GnuPG build with NTBTLS support does not anymore block for dozens of seconds before returning data. * gpg: Fix bug in --show-keys which actually imported revocation certificates * gpg: Ignore too long user-ID and comment packets * gpg: Fix crash due to bad German translation. Improved printf format compile time check. * gpg: Handle missing ISSUER sub packet gracefully in the presence of the new ISSUER_FPR * gpg: Allow decryption using several passphrases in most cases. * gpg: Command --show-keys now enables the list options show-unusable-uids, show-unusable-subkeys, show-notations and show-policy-urls by default. * gpg: Command --show-keys now prints revocation certificates. * gpg: Add revocation reason to the "rev" and "rvs" records of the option --with-colons. [#1173] * gpg: Export option export-clean does now remove certain expired subkeys; export-minimal removes all expired subkeys. * gpg: New "usage" property for the drop-subkey filters.- Update to version 2.2.8: * gpg: Decryption of messages not using the MDC mode will now lead to a hard failure even if a legacy cipher algorithm was used. The option - -ignore-mdc-error can be used to turn this failure into a warning. Take care: Never use that option unconditionally or without a prior warning. * gpg: The MDC encryption mode is now always used regardless of the cipher algorithm or any preferences. For testing --rfc2440 can be used to create a message without an MDC. * gpg: Sanitize the diagnostic output of the original file name in verbose mode (bsc#1096745, CVE-2018-12020) * gpg: Detect suspicious multiple plaintext packets in a more reliable way. * gpg: Fix the duplicate key signature detection code. * gpg: The options --no-mdc-warn, --force-mdc, --no-force-mdc, - -disable-mdc and --no-disable-mdc have no more effect. * agent: Add DBUS_SESSION_BUS_ADDRESS and a few other envvars to the list of startup environment variables. - Refresh gnupg-2.0.18-files-are-digests.patch to gnupg-2.2.8-files-are-digests.patch- GnuPG 2.2.7: * gpg: New option --no-symkey-cache to disable the passphrase cache for symmetrical en- and decryption. * gpg: The ERRSIG status now prints the fingerprint if that is part of the signature * gpg: Relax emitting of FAILURE status lines * gpg: Add a status flag to "sig" lines printed with --list-sigs * gpg: Fix "Too many open files" when using --multifile * ssh: Return an error for unknown ssh-agent flags * dirmngr: Fix a CNAME problem with pools and TLS. Also use a fixed mapping of keys.gnupg.net to sks-keyservers.net * dirmngr: Try resurrecting dead hosts earlier (from 3h to 1.5h) * dirmngr: Fallback to CRL if no default OCSP responder is configured * dirmngr: Implement CRL fetching via https. Here a redirection to http is explictly allowed * agent,dirmngr: New sub-command "getenv" for "getinfo" to ease debugging- GnuPG 2.2.6: * gpg,gpgsm: New option --request-origin to pretend requests coming from a browser or a remote site. * gpg: Fix race condition on trustdb.gpg updates due to too early released lock. * gpg: Emit FAILURE status lines in almost all cases. * gpg: Implement --dry-run for --passwd to make checking a key's passphrase straightforward. * gpg: Make sure to only accept a certification capable key for key signatures. * gpg: Better user interaction in --card-edit for the factory-reset sub-command. * gpg: Improve changing key attributes in --card-edit by adding an explicit "key-attr" sub-command. * gpg: Print the keygrips in the --card-status. * scd: Support KDF DO setup. * scd: Fix suspend/resume handling in the CCID driver. * agent: Evict cached passphrases also via a timer. * agent: Use separate passphrase caches depending on the request origin. * ssh: Support signature flags. * dirmngr: Handle failures related to missing IPv6 support gracefully. * Allow the use of UNC directory names as homedir. [#3818] - Dropped gnupg-CVE-2018-9234.patch since it is included upstream- Added gnupg-CVE-2018-9234.patch: Enforce that key certification can only be done with the master key, and not a signing subkey. (bnc#1088255 CVE-2018-9234)- GnuPG 2.2.5: * gpg: Allow the use of the "cv25519" and "ed25519" short names in addition to the canonical curve names in --batch --gen-key * gpg: Make sure to print all secret keys with option --list-only and --decrypt * gpg: Fix the use of future-default with --quick-add-key for signing keys * gpg: Select a secret key by checking availability under gpg-agent * gpg: Fix reversed prompt texts for --only-sign-text-ids * gpg,gpgsm: Fix detection of bogus keybox blobs on 32 bit systems * gpgsm: Fix regression since 2.1 in --export-secret-key-raw which got $d mod (q-1)$ wrong * scd: Support the KDF Data Object of the OpenPGP card 3.3 * scd: Fix a regression in the internal CCID driver for certain card readers * dirmngr: Improve returned error description on failure of DNS resolving * wks: Implement command --install-key for gpg-wks-server.- Use %license (boo#1082318)- GnuPG 2.2.4: * gpg: Change default preferences to prefer SHA512. * gpg: Print a warning when more than 150 MiB are encrypted using a cipher with 64 bit block size. * gpg: Print a warning if the MDC feature has not been used for a message. * gpg: Fix regular expression of domain addresses in trust signatures * agent: New option --auto-expand-secmem to help with high numbers of concurrent connections. Requires libgcrypt 1.8.2 for having an effect. * dirmngr: Cache responses of WKD queries. * gpgconf: Add option --status-fd. * wks: Add commands --check and --remove-key to gpg-wks-server * Increase the backlog parameter of the daemons to 64 and add option --listen-backlog. - Not enabled features: * New configure option --enable-run-gnupg-user-socket to first try a socket directory which is not removed by systemd at session end.- GnuPG 2.2.3: * dirmngr: Fix crash in case of a CRL loading error * gpgtar: Fix wrong behaviour of --set-filename * gpg: Silence AKL retrieval messages * agent: Use clock or clock_gettime for calibration * agent: Improve robustness of the shutdown pending state- GnuPG 2.2.2: * gpg: Avoid duplicate key imports by concurrently running gpg processes * gpg: Fix creating on-disk subkey with on-card primary key * gpg: Fix validity retrieval for multiple keyrings * gpg: Fix --dry-run and import option show-only for secret keys * gpg: Print "sec" or "sbb" for secret keys with import option import-show * gpg: Make import less verbose * gpg: Add alias "Key-Grip" for parameter "Keygrip" and new parameter "Subkey-Grip" to unattended key generation * gpg: Improve "factory-reset" command for OpenPGP cards * gpg: Ease switching Gnuk tokens into ECC mode by using the magic keysize value 25519 * gpgsm: Fix --with-colon listing in crt records for fields > 12. * gpgsm: Do not expect X.509 keyids to be unique * agent: Fix stucked Pinentry when using --max-passphrase-days * agent: New option --s2k-count * dirmngr: Do not follow https-to-http redirects * dirmngr: Reduce default LDAP timeout from 100 to 15 seconds * gpgconf: Ignore non-installed components for commands - -apply-profile and --apply-defaults * Add configure option --enable-werror- GnuPG 2.2.1: * gpg: Fix formatting of the user id in batch mode key generation if only "name-email" is given. * gpgv: Fix annoying "not suitable for" warnings. * wks: Convey only the newest user id to the provider. This is the case if different names are used with the same addr-spec. * wks: Create a complying user id for provider policy mailbox-only. * wks: Add workaround for posteo.de. * scd: Fix the use of large ECC keys with an OpenPGP card. * dirmngr: Use system provided root certificates if no specific HKP certificates are configured. If bu- GnuPG 2.2.0: * New long term stable branch, replacing the 2.0.x series * gpg: Reverted change in 2.1.23 so that --no-auto-key-retrieve is again the default boo#1054088 * Fixed a few minor bugs- GnuPG 2.1.23: * gpg: Options --auto-key-retrieve and --auto-key-locate "local,wkd" are now used by default. Note: this enables keyserver and Web Key Directory operators to notice when a signature from a locally non-available key is being verified for the first time or when you intend to encrypt to a mail address without having the key locally. This new behaviour will eventually make key discovery much easier and mostly automatic. Disable this by adding no-auto-key-retrieve auto-key-locate local to your gpg.conf. * agent: Option --no-grab is now the default. The new option --grab allows to revert this. * gpg: New import option "show-only". * gpg: New option --disable-dirmngr to entirely disable network access for gpg. * gpg,gpgsm: Tweaked DE-VS compliance behaviour. * New configure flag --enable-all-tests to run more extensive tests during "make check". * gpgsm: The keygrip is now always printed in colon mode as documented in the man page.- GnuPG 2.1.22: * gpg: Extend command --quick-set-expire to allow for setting the expiration time of subkeys. * gpg: By default try to repair keys during import. New sub-option no-repair-keys for --import-options. * gpg,gpgsm: Improved checking and reporting of DE-VS compliance. * gpg: New options --key-origin and --with-key-origin. Store the time of the last key update from keyservers, WKD, or DANE. * agent: New option --ssh-fingerprint-digest. * dimngr: Lower timeouts on keyserver connection attempts and made it configurable. * dirmngr: Tor will now automatically be detected and used. The option --no-use-tor disables Tor detection. * dirmngr: Now detects a changed /etc/resolv.conf. * agent,dirmngr: Initiate shutdown on removal of the GnuPG home directory. * gpg: Avoid caching passphrase for failed symmetric encryption. * agent: Support for unprotected ssh keys. * dirmngr: Fixed name resolving on systems using only v6 nameservers. * dirmngr: Allow the use of TLS over http proxies. * wks: New man pages for client and server.- GnuPG 2.1.21: * modified gnupg-2.0.18-files-are-digests.patch to work with obs-sign again bsc#1039899- GnuPG 2.1.21: * gpg,gpgsm: Fix corruption of old style keyring.gpg files, regression in 2.1.20 * gpg,dirmngr: Removed the skeleton config file support New installations no longer generate a configuration file. In the absence of a file, SHA-2 family hashes are used. Existing configurations are not touched. drop gnupg-2.1.19-stronger-defaults.patch FATE#323084 * gpg: Fixed import filter property match bug. * scd: Removed Linux support for Cardman 4040 PCMCIA reader. * scd: Fixed some corner case bugs in resume/suspend handling. * Many minor bug fixes and code cleanup.- GnuPG 2.1.20: * gpg: New properties 'expired', 'revoked', and 'disabled' for the import and export filters. * gpg: New command --quick-set-primary-uid. * gpg: New compliance field for the --with-colon key listing. * gpg: Changed the key parser to generalize the processing of local meta data packets. * gpg: Fixed assertion failure in the TOFU trust model. * gpg: Fixed exporting of zero length user ID packets. * scd: Improved support for multiple readers. * scd: Fixed timeout handling for key generation. * agent: New option --enable-extended-key-format. * dirmngr: Do not add a keyserver to a new dirmngr.conf. Dirmngr uses a default keyserver. * dimngr: Do not treat TLS warning alerts as severe error when building with GNUTLS. * dirmngr: Actually take /etc/hosts in account. * wks: Fixed client problems on Windows. Published keys are now set to world-readable. * tests: Fixed creation of temporary directories. * A socket directory for a non standard GNUGHOME is now created on the fly under /run/user. Thus "gpgconf --create-socketdir" is now optional. The use of "gpgconf --remove-socketdir" to clean up obsolete socket directories is however recommended to avoid cluttering /run/user with useless directories. * Fixed build problems on some platforms.- Use stronger defaults for new users, using SHA-2 digest family for certificates and message signatures - FATE#323084 adding gnupg-2.1.19-stronger-defaults.patch- GnuPG 2.1.19: * gpg: Print a warning if Tor mode is requested but the Tor daemon is not running. * gpg: New status code DECRYPTION_KEY to print the actual private key used for decryption. * gpgv: New options --log-file and --debug. * gpg-agent: Revamp the prompts to ask for card PINs. * scd: Support for multiple card readers. * scd: Removed option --debug-disable-ticker. Ticker is used only when it is required to watch removal of device/card. * scd: Improved detection of card inserting and removal. * dirmngr: New option --disable-ipv4. * dirmngr: New option --no-use-tor to explicitly disable the use of Tor. * dirmngr: The option --allow-version-check is now required even if the option --use-tor is also used. * dirmngr: Handle a missing nsswitch.conf gracefully. * dirmngr: Avoid PTR lookups for keyserver pools. The are only done for the debug command "keyserver --hosttable". * dirmngr: Rework the internal certificate cache to support classes of certificates. Load system provided certificates on startup. * Add options --tls, --no-crl, and --systrust to the "VALIDATE" command. * dirmngr: Add support for the ntbtls library. * wks: Create mails with a "WKS-Phase" header. Fix detection of Draft-2 mode. * Many other bug fixes and new regression tests. - dirmngr: use system certificate store- Rewrite descriptions- GnuPG 2.1.18: * gpg: Remove bogus subkey signature while cleaning a key (with export-clean, import-clean, or --edit-key's sub-command clean) * gpg: Allow freezing the clock with --faked-system-time. * gpg: New --export-option flag "backup", new --import-option flag "restore". * gpg-agent: Fixed long delay due to a regression in the progress callback code. * scd: Lots of code cleanup and internal changes. * scd: Improved the internal CCID driver. * dirmngr: Fixed problem with the DNS glue code (removal of the trailing dot in domain names). * dirmngr: Make sure that Tor is actually enabled after changing the conf file and sending SIGHUP or "gpgconf --reload dirmngr". * dirmngr: Fixed Tor access to IPv6 addresses. Note that current versions of Tor may require that the flag "IPv6Traffic" is used with the option "SocksPort" in torrc to actually allow IPv6 traffic. * dirmngr: Fixed HKP for literally given IPv6 addresses. * dirmngr: Enabled reverse DNS lookups via Tor. * dirmngr: Added experimental SRV record lookup for WKD. See commit 88dc3af3d4ae1afe1d5e136bc4c38bc4e7d4cd10 for details. * dirmngr: For HKP use "pgpkey-hkps" and "pgpkey-hkp" in SRV record lookups. Avoid SRV record lookup when a port is explicitly specified. This fixes a regression from the 1.4 and 2.0 behavior. * dirmngr: Gracefully handle a missing /etc/nsswitch.conf. Ignore negation terms (e.g. "[!UNAVAIL=return]" instead of bailing out. * dirmngr: Better debug output for flags "dns" and "network". * dirmngr: On reload mark all known HKP servers alive. * gpgconf: Allow keyword "all" for --launch, --kill, and --reload. * tools: gpg-wks-client now ignores a missing policy file on the server. * Avoid unnecessary ambiguity error message in the option parsing. * Further improvements of the regression test suite. * Fixed building with --disable-libdns configure option. * Fixed a crash running the tests on 32 bit architectures. * Fixed spurious failures on BSD system in the spawn functions. This affected for example gpg-wks-client and gpgconf.- Remove the fixme, condition around fdupes- add runtime dependency to match runtime version check for libksba- GnuPG 2.1.17: * gpg: By default new keys expire after 2 years. * gpg: New command --quick-set-expire to conveniently change the expiration date of keys. * gpg: Option and command names have been changed for easier comprehension. The old names are still available as aliases. * gpg: Improved the TOFU trust model. * gpg: New option --default-new-key-algo. * scd: Support OpenPGP card V3 for RSA. * dirmngr: Support for the ADNS library has been removed. Now using bundled libdns, enabling Tor support on all platforms. New option --standard-resolver can be used to disable this code at runtime. * dirmngr: Lazily launch ldap reaper thread. * tools: New options --check and --status-fd for gpg-wks-client. * The UTF-8 byte order mark is now skipped when reading conf files. * Fixed many bugs and regressions. * Major improvements to the test suite. For example it is possible to run the external test suite of GPGME.- GnuPG 2.1.16: * gpg: New algorithm for selecting the best ranked public key when using a mail address with -r, -R, or --locate-key. * gpg: New option --with-tofu-info to print a new "tfs" record in colon formatted key listings. * gpg: New option --compliance as an alternative way to specify options like --rfc2440, --rfc4880, et al. * gpg: Many changes to the TOFU implementation. * gpg: Improve usability of --quick-gen-key. * gpg: In --verbose mode print a diagnostic when a pinentry is launched. * gpg: Remove code which warns for old versions of gnome-keyring. * gpg: New option --override-session-key-fd. * gpg: Option --output does now work with --verify. * gpgv: New option --output to allow saving the verified data. * gpgv: New option --enable-special-filenames. * agent, dirmngr: New --supervised mode for use by systemd and alike. * agent: By default listen on all available sockets using standard names. * agent: Invoke scdaemon with --homedir. * dirmngr: On Linux now detects the removal of its own socket and terminates. * scd: Support ECC key generation. * scd: Support more card readers. * dirmngr: New option --allow-version-check to download a software version database in the background. * dirmngr: Use system provided CAs if no --hkp-cacert is given. * dirmngr: Use a default keyserver if none is explicitly set * gpgconf: New command --query-swdb to check software versions against an copy of an online database. * gpgconf: Print the socket directory with --list-dirs. * tools: The WKS tools now support draft version -02. * tools: Always build gpg-wks-client and install under libexec. * tools: New option --supported for gpg-wks-client. * The log-file option now accepts a value "socket://" to log to the socket named "S.log" in the standard socket directory. * Provide fake pinentries for use by tests cases of downstream developers. * Fixed many bugs and regressions. * Many changes and improvements for the test suite. - drop upstreamed patches: * 0001-common-Follow-up-to-14479e2-fix-void-return-in-non-v.patch * gnupg-2.1.15-bsc993324-status-output.patch- avoid mixing up status and colon line output - bsc#993324 add gnupg-2.1.15-bsc993324-status-output.patch- enable web key discovery tools- Add an explicit runtime dependency on libgcrypt >= 1.7.0 to match runtime version check- GnuPG 2.1.15: * gpg: Remove the --tofu-db-format option and support for the split TOFU database. * gpg: Add option --sender to prepare for coming features. * gpg: Add option --input-size-hint to help progress indicators. * gpg: Extend the PROGRESS status line with the counted unit. * gpg: Avoid publishing the GnuPG version by default with --armor. * gpg: Properly ignore legacy keys in the keyring cache. * gpg: Always print fingerprint records in --with-colons mode. * gpg: Make sure that keygrips are printed for each subkey in - -with-colons mode. * gpg: New import filter "drop-sig". * gpgsm: Fix a bug in the machine-readable key listing. * gpg,gpgsm: Block signals during keyring updates to limits the effects of a Ctrl-C at the wrong time. * g13: Add command --umount and other fixes for dm-crypt. * agent: Fix regression in SIGTERM handling. * agent: Cleanup of the ssh-agent code. * agent: Allow import of overly long keys. * scd: Fix problems with card removal. * dirmngr: Remove all code for running as a system service. * tools: Make gpg-wks-client conforming to the specs. * tests: Improve the output of the new regression test tool. * tests: Distribute the standalone test runner. * tests: Run each test in a clean environment. * Spelling and grammar fixes. - fix build error, adding 0001-common-Follow-up-to-14479e2-fix-void-return-in-non-v.patch- GnuPG 2.1.14: * gpg: Removed options --print-dane-records and --print-pka-records. The new export options "export-pka" and "export-dane" can instead be used with the export command. * gpg: New options --import-filter and --export-filter. * gpg: New import options "import-show" and "import-export". * gpg: New option --no-keyring. * gpg: New command --quick-revuid. * gpg: New options -f/--recipient-file and -F/--hidden-recipient-file to directly specify encryption keys. * gpg: New option --mimemode to indicate that the content is a MIME part. Does only enable --textmode right now. * gpg: New option --rfc4880bis to allow experiments with proposed changes to the current OpenPGP specs. * gpg: Fix regression in the "fetch" sub-command of --card-edit. * gpg: Fix regression since 2.1 in option --try-all-secrets. * gpgv: Change default options for extra security. * gpgsm: No more root certificates are installed by default. * agent: "updatestartuptty" does now affect more environment variables. * scd: The option --homedir does now work with scdaemon. * scd: Support some more GEMPlus card readers. * gpgtar: Fix handling of '-' as file name. * gpgtar: New commands --create and --extract. * gpgconf: Tweak for --list-dirs to better support shell scripts. * tools: Add programs gpg-wks-client and gpg-wks-server to implement a Web Key Service. The configure option --enable-wks-tools is required to build them; they should be considered Beta software. * tests: Complete rework of the openpgp part of the test suite. The test scripts have been changed from Bourne shell scripts to Scheme programs. A customized scheme interpreter (gpgscm) is included. This change was triggered by the need to run the test suite on non-Unix platforms. * The rendering of the man pages has been improved. - drop upstream gnupg-make_--try-all-secrets_work.patch- Fix date call as the curlified parameter for sure are not parsed correctly by escaping it with %- Fix upstream bug 1985: --try-all-secrets doesn't work when decrypting messages encrypted with --hidden-recipient, fixes unit tests of the duplicity package. Adding gnupg-make_--try-all-secrets_work.patch - record the fact that gpg-error 1.21 is required- GnuPG 2.1.13: * gpg: New command --quick-addkey. Extend the --quick-gen-key command. * gpg: New --keyid-format "none" which is now also the default. * gpg: New option --with-subkey-fingerprint. * gpg: Include Signer's UID subpacket in signatures if the secret key has been specified using a mail address and the new option - -disable-signer-uid is not used. * gpg: Allow unattended deletion of a secret key. * gpg: Allow export of non-passphrase protected secret keys. * gpg: New status lines KEY_CONSIDERED and NOTATION_FLAGS. * gpg: Change status line TOFU_STATS_LONG to use '~' as a non-breaking-space character. * gpg: Speedup key listings in Tofu mode. * gpg: Make sure that the current and total values of a PROGRESS status line are small enough. * gpgsm: Allow the use of AES192 and SERPENT ciphers. * dirmngr: Adjust WKD lookup to current specs. * dirmngr: Fallback to LDAP v3 if v2 is is not supported. * gpgconf: New commands --create-socketdir and --remove-socketdir, new option --homedir. * If a /run/user/$UID directory exists, that directory is now used for IPC sockets instead of the GNUPGHOME directory. This fixes problems with NFS and too long socket names and thus avoids the need for redirection files. * Speedup fd closing after a fork. - drop upstreamed gnupg-fix-signature-checking.patch- add gnupg-fix-signature-checking.patch (bsc#981020) https://bugs.gnupg.org/gnupg/issue2351- GnuPG 2.1.12: * gpg: New --edit-key sub-command "change-usage" for testing purposes. * gpg: Out of order key-signatures are now systematically detected and fixed by --edit-key. * gpg: Improved detection of non-armored messages. * gpg: Removed the extra prompt needed to create Curve25519 keys. * gpg: Improved user ID selection for --quick-sign-key. * gpg: Use the root CAs provided by the system with --fetch-key. * gpg: Add support for the experimental Web Key Directory key location service. * gpg: Improve formatting of Tofu messages and emit new Tofu specific status lines. * gpgsm: Add option --pinentry-mode to support a loopback pinentry. * gpgsm: A new pubring.kbx is now created with the header blob so that gpg can detect that the keybox format needs to be used. * agent: Add read support for the new private key protection format openpgp-s2k-ocb-aes. * agent: Add read support for the new extended private key format. * agent: Default to --allow-loopback-pinentry and add option - -no-allow-loopback-pinentry. * scd: Changed to use the new libusb 1.0 API for the internal CCID driver. * dirmngr: The dirmngr-client does now auto-detect the PEM format. * g13: Add experimental support for dm-crypt. * The man pages for gpg and gpgv are now installed under the correct name (gpg2 or gpg - depending on a configure option).- GnuPG 2.1.11: * gpg: New command --export-ssh-key to replace the gpgkey2ssh tool. * gpg: Allow to generate mail address only keys with --gen-key. * gpg: "--list-options show-usage" is now the default. * gpg: Make lookup of DNS CERT records holding an URL work. * gpg: Emit PROGRESS status lines during key generation. * gpg: Don't check for ambigious or non-matching key specification in the config file or given to --encrypt-to. This feature will return in 2.3.x. * gpg: Lock keybox files while updating them. * gpg: Fix possible keyring corruption. (bug#2193) * gpg: Fix regression of "bkuptocard" sub-command in --edit-key and remove "checkbkupkey" sub-command introduced with 2.1. (bug#2169) * gpg: Fix internal error in gpgv when using default keyid-format. * gpg: Fix --auto-key-retrieve to work with dirmngr.conf configured keyservers. (bug#2147). * agent: New option --pinentry-timeout. * scd: Fix regression for generating RSA keys on card. * dirmmgr: All configured keyservers are now searched. * dirmngr: Install CA certificate for hkps.pool.sks-keyservers.net. Use this certiticate even if --hkp-cacert is not used. * gpgtar: Add actual encryption code. gpgtar does now fully replace gpg-zip. * gpgtar: Fix filename encoding problem on Windows. * Print a warning if a GnuPG component is using an older version of gpg-agent, dirmngr, or scdaemon. - disable running test which no longer work - remove 0001-gpg-Improve-the-keyblock-cache-s-transparency.patch is now upstream - the PIE options are implemented in the upstream build, and spec code broke the build. The only remaining broken executable was gpgsplit, which was removed from the package- add g13, an experimental tool for accessing encrypted storage with with GnuPG (cards)- fix fingerprint ambiguity (bsc#958891) * https://bugs.gnupg.org/gnupg/issue2198 * add 0001-gpg-Improve-the-keyblock-cache-s-transparency.patch- Move to pkgconfig() packaging style- GnuPG 2.1.10 adds TOFU (Trust-On-First-USe) and anonymous key retrival via Tor. * gpg: New trust models "tofu" and "tofu+pgp". * gpg: New command --tofu-policy. New options --tofu-default-policy and --tofu-db-format. * gpg: New option --weak-digest to specify hash algorithms which should be considered weak. * gpg: Allow the use of multiple --default-key options; take the last available key. * gpg: New option --encrypt-to-default-key. * gpg: New option --unwrap to only strip the encryption layer. * gpg: New option --only-sign-text-ids to exclude photo IDs from key signing. * gpg: Check for ambigious or non-matching key specification in the config file or given to --encrypt-to. * gpg: Show the used card reader with --card-status. * gpg: Print export statistics and an EXPORTED status line. * gpg: Allow selecting subkeys by keyid in --edit-key. * gpg: Allow updating the expiration time of multiple subkeys at once. * dirmngr: New option --use-tor. For full support this requires libassuan version 2.4.2 and a patched version of libadns (e.g. adns-1.4-g10-7 as used by the standard Windows installer). * dirmngr: New option --nameserver to specify the nameserver used in Tor mode. * dirmngr: Keyservers may again be specified by IP address. * dirmngr: Fixed problems in resolving keyserver pools. * dirmngr: Fixed handling of premature termination of TLS streams so that large numbers of keys can be refreshed via hkps. * gpg: Fixed a regression in --locate-key [since 2.1.9]. * gpg: Fixed another bug for keyrings with legacy keys. * gpgsm: Allow combinations of usage flags in --gen-key. * Make tilde expansion work with most options. * Many other cleanups and bug fixes.- enable tests for PPC64 again, the problem from bsc#935887 went away- Improve upgrade to gpg2 from security:privacy w.r.t. libassuan run-time dependencies (boo#955982)- GnuPG 2.1.9: * gpg: Allow fetching keys via OpenPGP DANE (--auto-key-locate).\ New option --print-dane-records. * gpg: Fix for a problem with PGP-2 keys in a keyring. * gpg: Fail with an error instead of a warning if a modern cipher algorithm is used without a MDC. * agent: New option --pinentry-invisible-char. * agent: Always do a RSA signature verification after creation. * agent: Fix a regression in ssh-add-ing Ed25519 keys. * agent: Fix ssh fingerprint computation for nistp384 and EdDSA. * agent: Fix crash during passprase entry on some platforms. * scd: Change timeout to fix problems with some 2.1 cards. * dirmngr: Displayed name is now Key Acquirer. * dirmngr: Add option --keyserver. Deprecate that option for gpg. Install a dirmngr.conf file from a skeleton for new installations. - update gnupg-add_legacy_FIPS_mode_option.patch for context change- GnuPG 2.1.8: * gpg: Sending very large keys to the keyservers works again. * gpg: Validity strings in key listings are now again translatable. * gpg: Emit FAILURE status lines to help GPGME. * gpg: Does not anymore link to Libksba to reduce dependencies. * gpgsm: Export of secret keys via Assuan is now possible. * agent: Raise the maximum passphrase length from 100 to 255 bytes. * agent: Fix regression using EdDSA keys with ssh. * Does not anymore use a build timestamp by default. * The fallback encoding for broken locale settings changed from Latin-1 to UTF-8. * Many code cleanups and improved internal documentation. * Various minor bug fixes.- GnuPG 2.1.7: * gpg: Support encryption with Curve25519 if Libgcrypt 1.7 is used. * gpg: In the --edit-key menu: Removed the need for "toggle", changed how secret keys are indicated, new commands "fpr *" and "grip". * gpg: More fixes related to legacy keys in a keyring. * gpgv: Does now also work with a "trustedkeys.kbx" file. * scd: Support some feature from the OpenPGP card 3.0 specs. * scd: Improved ECC support * agent: New option --force for the DELETE_KEY command. * Dropped deprecated gpgsm-gencert.sh * Various other bug fixes.- do not run checks on ppc64 for now- GnuPG 2.1.6: * agent: New option --verify for the PASSWD command. * gpgsm: Add command option "offline" as an alternative to - -disable-dirmngr. * gpg: Do not prompt multiple times for a password in pinentry loopback mode. * Allow the use of debug category names with --debug. * Using gpg-agent and gpg/gpgsm with different locales will now show the correct translations in Pinentry. * gpg: Improve speed of --list-sigs and --check-sigs. * gpg: Make --list-options show-sig-subpackets work again. * gpg: Fix an export problem for old keyrings with PGP-2 keys. * scd: Support PIN-pads on more readers. * dirmngr: Properly cleanup zombie LDAP helper processes and avoid hangs on dirmngr shutdown. * Various other bug fixes. - remove documentation make workaround, fixed upstream- Enable workaround for missing dependencies everywhere- fix build with openSUSE 13.2 and earlier, call make to compensate for incorrect documentation dependencies.- GnuPG 2.1.5: * Support for an external passphrase cache. * Support for the forthcoming version 3 OpenPGP smartcard. * Manuals now show the actual used file names. * Prepared for improved integration with Emacs. * Code cleanups and minor bug fixes.- info deinstall needs to be in %preun- update to 2.1.4: * gpg: Add command --quick-adduid to non-interacitivly add a new user id to an existing key. * gpg: Do no enable honor-keyserver-url by default. Make it work if enabled. * gpg: Display the serial number in the --card-staus output again. * agent: Support for external password managers. Add option --no-allow-external-cache. * scdaemon: Improved handling of extended APDUs. * Make HTTP proxies work again. * All network access including DNS as been moved to Dirmngr. * Allow building without LDAP support. * Fixed lots of smaller bugs.- update to 2.1.3: * gpg: LDAP keyservers are now supported by 2.1. * gpg: New option --with-icao-spelling. * gpg: New option --print-pka-records. Changed the PKA method to use CERT records and hashed names. * gpg: New command --list-gcrypt-config. New parameter "curve" for --list-config. * gpg: Print a NEWSIG status line like gpgsm always did. * gpg: Print MPI values with --list-packets and --verbose. * gpg: Write correct MPI lengths with ECC keys. * gpg: Skip legacy PGP-2 keys while searching. (drop 0001-gpg-Skip-legacy-keys-while-searching-keyrings.patch now upstream) * gpg: Improved searching for mail addresses when using a keybox. * gpgsm: Changed default algos to AES-128 and SHA-256. * gpgtar: Fixed extracting files with sizes of a multiple of 512. * dirmngr: Fixed SNI handling for hkps pools. (drop hkps-fix-host-name-verification-when-using-pools.patch now upstream) * dirmngr: extra-certs and trusted-certs are now always loaded from the sysconfig dir instead of the homedir. * Fixed possible problems due to compiler optimization, two minor regressions, and other bugs. - refreshed for context changes: * gnupg-2.0.18-files-are-digests.patch * gnupg-add_legacy_FIPS_mode_option.patch- Add hkps-fix-host-name-verification-when-using-pools.patch to fix hkps support w/ pools. Upstream commit dc10d46.- Ensure secure memory can be used with default 64k memlock limit Fixes [boo#915931], removes gnupg-large_keys.patch - Removed gnupg-remove_development_version_warning.patch, obsolete - Removed gnupg-2.0.4-install_tools.diff, replaced by spec install - Removed autoconf requirement and autoreconf calls thus obsoleted- Fix invalid packet read error when reading keyrings [boo#914625] add 0001-gpg-Skip-legacy-keys-while-searching-keyrings.patch- update to 2.1.2: * gpg: The parameter 'Passphrase' for batch key generation works again. * gpg: Using a passphrase option in batch mode now has the expected effect on --quick-gen-key. * gpg: Improved reporting of unsupported PGP-2 keys. * gpg: Added support for algo names when generating keys using - -command-fd. * gpg: Fixed DoS based on bogus and overlong key packets. * agent: When setting --default-cache-ttl the value for --max-cache-ttl is adjusted to be not lower than the former. * agent: Fixed problems with the new --extra-socket. * agent: Made --allow-loopback-pinentry changeable with gpgconf. * agent: Fixed importing of unprotected openpgp keys. * agent: Now tries to use a fallback pinentry if the standard pinentry is not installed. * scd: Added support for ECDH. * Fixed several bugs related to bogus keyrings and improved some other code. - in gnupg-2.0.18-files-are-digests.patch, change buffer_to_u32 to buf32_to_u32 from host2net.h to match upstream changes - now requires automake 1.14- update to 2.1.1: * gpg: Detect faulty use of --verify on detached signatures. * gpg: New import option "keep-ownertrust". * gpg: New sub-command "factory-reset" for --card-edit. * gpg: A stub key for smartcards is now created by --card-status. * gpg: Fixed regression in --refresh-keys. * gpg: Fixed regresion in %g and %p codes for --sig-notation. * gpg: Fixed best matching hash algo detection for ECDSA and EdDSA. * gpg: Improved perceived speed of secret key listisngs. * gpg: Print number of skipped PGP-2 keys on import. * gpg: Removed the option aliases --throw-keyid and --notation-data; use --throw-keyids and --set-notation instead. * gpg: New import option "keep-ownertrust". * gpg: Skip too large keys during import. * gpg,gpgsm: New option --no-autostart to avoid starting gpg-agent or dirmngr. * gpg-agent: New option --extra-socket to provide a restricted command set for use with remote clients. * gpgconf --kill does not anymore start a service only to kill it. * gpg-pconnect-agent: Add convenience option --uiserver. * More translations (but most of them are not complete). * To support remotely mounted home directories, the IPC sockets may now be redirected. This feature requires Libassuan 2.2.0. * Improved portability and the usual bunch of bug fixes. - removed patch not part of upstream release: gnupg-2.1.0-boo-907198-openpgp_oid_to_str-buffer-overflow.patch - refresh for context changes: gnupg-2.0.18-files-are-digests.patch gnupg-2.0.4-install_tools.diff - refresh for upstream code changes: gnupg-add_legacy_FIPS_mode_option.patch gnupg-detect_FIPS_mode.patch (MD5 removed)- Support for large RSA keys This involves compiling with --enable-large-rsa and - -enable-large-secmem, as well as patching the number of secmem bytes and IPC bytes to slightly larger values. See https://bugs.debian.org/cgi-bin/bugreport.cgi?bug=739424 * added gnupg-large_keys.patch- update build requirement versions that changed with 2.1.0- fix buffer overflow in OID to string conversion function [boo#907198], adding gnupg-2.1.0-boo-907198-openpgp_oid_to_str-buffer-overflow.patch- obsolete dirmngr (shipped with gpg since 2.1.0) - spec cleanup after previous update - get rid of "THIS IS A DEVELOPMENT VERSION" warning http://lists.gnupg.org/pipermail/gnupg-devel/2014-November/029065.html * added gnupg-remove_development_version_warning.patch- upgrade to 2.1.0 (modern) - The file "secring.gpg" is not anymore used to store the secret keys. Merging of secret keys is now supported. - All support for PGP-2 keys has been removed for security reasons. - The standard key generation interface is now much leaner. This will help a new user to quickly generate a suitable key. - Support for Elliptic Curve Cryptography (ECC) is now available. - Commands to create and sign keys from the command line without any extra prompts are now available. - The Pinentry may now show the new passphrase entry and the passphrase confirmation entry in one dialog. - There is no more need to manually start the gpg-agent. It is now started by any part of GnuPG as needed. - Problems with importing keys with the same long key id have been addressed. - The Dirmngr is now part of GnuPG proper and also takes care of accessing keyserver. - Keyserver pools are now handled in a smarter way. - A new format for locally storing the public keys is now used. This considerable speeds up operations on large keyrings. - Revocation certificates are now created by default. - Card support has been updated, new readers and token types are supported. - The format of the key listing has been changed to better identify the properties of a key. - The gpg-agent may now be used on Windows as a Pageant replacement for Putty in the same way it is used for years on Unix as ssh-agent replacement. - Creation of X.509 certificates has been improved. It is now also possible to export them directly in PKCS#8 and PEM format for use on TLS servers. - dropped patches: * gnupg-2.0.20-automake113.diff * gnupg-2.0.18-tmpdir.diff (socket is created in homedir now) - refresh most of the remaining patches - added new BuildRequires: gnutls-devel, pkg-config, npth-devel/bin/shgpgibs-power9-17 1769691692 #%')+-./013456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~2.4.4-150600.3.15.12.4.41.4.92.4.4-150600.3.15.12.4.4-150600.3.15.11.4.9 gnupggpgconf.confg13gpggpg-agentgpg-cardgpg-connect-agentgpg-wks-clientgpg-wks-servergpg2gpgconfgpgparsemailgpgscmgpgsmgpgsplitgpgtargpgvgpgv2kbxutilwatchgnupggpg-authgpg-check-patterngpg-pair-toolgpg-preset-passphrasegpg-protect-toolgpg-wks-clientkeyboxdscdaemonsystemdusergpg-agent-browser.socketgpg-agent-extra.socketgpg-agent-ssh.socketgpg-agent.servicegpg-agent.socket60-scdaemon.rulesaddgnupghomeapplygnupgdefaultsg13-syshelpgpg2AUTHORSChangeLogDCODETAILSFAQHACKINGKEYSERVERNEWSOpenPGPREADMEREADME.systemdTHANKSTODOTRANSLATEexamplesREADMEcommon.confgpgconf.rnamespwpattern.listqualified.txtscd-eventtrustlist.txtgnupgdistsigkey.gpghelp.be.txthelp.ca.txthelp.cs.txthelp.da.txthelp.de.txthelp.el.txthelp.eo.txthelp.es.txthelp.et.txthelp.fi.txthelp.fr.txthelp.gl.txthelp.hu.txthelp.id.txthelp.it.txthelp.ja.txthelp.nb.txthelp.pl.txthelp.pt.txthelp.pt_BR.txthelp.ro.txthelp.ru.txthelp.sk.txthelp.sv.txthelp.tr.txthelp.txthelp.zh_CN.txthelp.zh_TW.txtgnupg.info-1.gzgnupg.info-2.gzgnupg.info-3.gzgnupg.info.gzgpg2COPYINGCOPYING.CC0COPYING.GPL2COPYING.LGPL21COPYING.LGPL3COPYING.othergpg-agent.1.gzgpg-card.1.gzgpg-check-pattern.1.gzgpg-connect-agent.1.gzgpg-preset-passphrase.1.gzgpg-wks-client.1.gzgpg-wks-server.1.gzgpg.1.gzgpg2.1.gzgpgconf.1.gzgpgparsemail.1.gzgpgsm.1.gzgpgtar.1.gzgpgv.1.gzgpgv2.1.gzscdaemon.1.gzwatchgnupg.1.gzgnupg.7.gzaddgnupghome.8.gzapplygnupgdefaults.8.gz/etc//etc/gnupg//usr/bin//usr/lib//usr/lib/systemd//usr/lib/systemd/user//usr/lib/udev/rules.d//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/gpg2//usr/share/doc/packages/gpg2/examples//usr/share//usr/share/gnupg//usr/share/info//usr/share/licenses//usr/share/licenses/gpg2//usr/share/man/man1//usr/share/man/man7//usr/share/man/man8/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:42496/SUSE_SLE-15-SP6_Update/fea44644a2a95b37260af76f45192047-gpg2.SUSE_SLE-15-SP6_Updatedrpmxz5ppc64le-suse-linux directoryASCII textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=cb4d07f77fd93f1af77ef38619fea332ec24154c, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=a73313bd67a5752d4b90b4e208349959ec7f3943, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=32982a9b2f9872f2fb10a99cb1606eac89aa9069, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=b97baafd3dd69766242347cae5cfd2cfe2f9fa55, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=d5fc1de1ad16b085aa38180ba3bff18066c4c18d, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=1e3d35e0b34b5a789d8a680de09a49addfa17809, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=dcf806bce98405178cbc8fe559bbb78c454d7079, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=320e3446da463a123c4ee7d92e5976fa4fe673ef, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=06882d2868f0305ba9686c3d7bb036752ddf1589, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=3fceec68d979f12510b163571b5345bf7a8626f8, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=a6ce28928cb849a60c255d7d54912ab2ae1aa0cd, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=16d2c00a24cae81a1ab9ad07a8a6a9df45d51a91, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=8b5303f05d613f214723c8e23ae860f00f1e9ed0, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=627d7b5ff9099bee9594dc922fff2ff751f252bf, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=79cb5e068029afc5a2570b0d95410c16f4144466, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=cc3b59456694d075ab571e90e7490c0e7da3776f, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=db1ce41bf9ce233d2b41b78429ac06e738aa3ea1, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=98dd807f735dd3cff2218af7735bc396e677efbe, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=7ac3f23bf5aed2df6064d8ca2f6a55d4202c8b1c, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=d70d33dcd7b3be6b4d0be4c03ef3c014a18d7c53, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=71a3149c0220f8e6990a397c292e50b179a13ea0, for GNU/Linux 4.3.0, strippedPOSIX shell script, ASCII text executableELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=3e490bbb0db0ba68eac2a9e0aebdb817becd2aa2, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=09340e2079a43e0cbf62017235e3b17dc968063b, for GNU/Linux 4.3.0, strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/ld64.so.2, BuildID[sha1]=1c871d282246a8f6c0713fdd339ebf3b600eaf39, for GNU/Linux 4.3.0, strippedUTF-8 Unicode texttroff or preprocessor input, UTF-8 Unicode text (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix),:GReps -./       RRRRR R R R R RRRRRRRRRR R R R R RRRRRRRRRR R R R R RRRRRRRRRRR R R R R RRRRRRRRRR R R R R RRRRRRRR R R R R RRRRRRR R R R R RRRRRRRRRRRRRRR R R R R RRRRR RRRRR R R R R RRRRRRRR R R R R RRRRRRRRRRRRRR R R R R RRRRRRRRR R R R R RRRRRRRR R R R R RRRRRRRRRRRRR R R R R RRRRRR R RRRRRR R R R R RRRRRRRR R R R R RRRRRRR R R R R RRRRRRRR R R R R RRRRRRRR R R R R RRRRRRRRRRR R R R R RRRRRRRRRRRRRRR R R R R RRRRRRRRRRRRRRR R R R R RRRRR3=0jVdirmngr2.4.4utf-8a01cac1855adda832ca732073c7968b55d472806f7798d28cb12bbbf7576c00f?7zXZ !t/ ]"k%ag,Rvw:'Z}Z{4}` |5zeb(b/D5A2jSWh&NRFJ y>hb;Cji:Q!V6}[Xfd W MJ[VG:E 9)J42^/B=T+@$܁&lL'\?_i~V6'm[KY=3ay ߳g8(I +|L<2f1Ji?b5d|RŰ}m_%bhiX~(K^ 14{S_`4>wF5(TGDgWҡt^Y<:3ȄtxQHM3eM@tpwv1ƠOS甯&"։PV8՟w,K@_v$m .kpo|Lr?sǙ[$ۑl7 Z/F'`)qdIΊ7T|)8~G[Af@,T,mLϠD|; 0.ҍciً1K:__5nYNW䰡C<3 2Z='md%+-NgDX_3fHi]FW(NF b9 KA1"تl8jB1y"Ex [,T7g%c\XGbOi>ؤnFudzd[æz'o0.3;-&KuN 7L٤ÿը}zyNRn͐8{p[Y(@+x1XwY}go,܅c`"^GV}~}S)pqapfsZVBq(L8; 5x.Rm[_ѻwrbwM#J8_6{bg:"@奭Jmt^4]%Kŧy2#KGmqR@A #)BpH.'cY>$QVFAhaGl {sjW*bw<ڏ?W &Cث_Y=FCuqi>Sj SNxy6a`ޙ@4ȥ8Bu 4/ +MPq* Z~Xxۥ> Q8N"(HelQDg;BCaL?qsr8&f3تR!`$MpJa.zfA\>C3ǢDb3QRKFl;1 ̓UUXvI>Y0\7*BϢz;EWTwHRќǿwg7jbRSs}0/B!IaW.<۫MAc)PQiiĶ1KӃFwMlGK&5ҋys,F2O 7Q @lNT5|tVQt \ f%uCh{ƂATzgM/ЯQ[iy ]2ZSs SD PR/)7OrQ2k Yq?*q<[_SWA H& M^wZ5Pk* 3P7=r~B7kquf]SެڏâZ"Ez{*:d" f$Q F M[VեMJg%QixKb$=m?!b\8)iL $B[x+ۙ5 1w3溚{(Nm>z>]8SO֪+^Q n̯>f׻ U"(-]Q,yA5*VYM{A`)x;Vb4ſO~%rJnhϕPRaKT@Y{W.([_J{ysc "'V׋[LQFa hj bӸ|Kmp}XniSEaܣކ$S*V(v|Fl?(x ,R? S|Nt!"EhȐSYo0y0ݸhbr( ܡFi$i I\c,Hԩ sbDf$iؕI,@ :Yb Z;mbr]l a]?qMe~AP%Avyu{cBu>q6[D͕xyU >+GƘ؀>sL}:%Ig}͛&0uf*w}I,zeGbF[us\x 0]7pljy@pH*a1Uh€&>8x&'7b陨T 4/AagpJ͗9B-tl4&PGk7gfNeXuOH T v?q jTjrF"Ju1z߲ͶȯXUPY=o&Kg|"WD_C'|KEzrNBƥw1ՠNP28K(Xdtf%,^,fK@'-xF ;mq6<=}0ʂ5%mid,*BvTr H4Z)"s?kOI̾Ú>0%B)_g'q[Al$[{OQ5nfF`{5T=|N;Ǟ7, s?&F6J$͹4{4s-|Cu_~@*R ,ѥcB0<2=V+.ϮQD^Z Ԡ\ވs2Ir F4V{ٻ9|oMDGu)v++T$$ YgםX!qmTDH6۬\!/)QǖJxO9rE0l GCc4)wvvӇ4սB BXV=ui1R!&zbȥt7l긔u;q,~9YRl *R놼7nk4|VoF(fkWɴ3(:ƃv8^ir[Aq#b0 i L؉*B.! ]?lGGͭ_<rX$$~uH4%]I擧0~+\4+P&=U=T7ܷ)\hm" ƅpv d2 dXL+,u?Bx:k:=b[Р1ә!@_ { F9DM:G֗;zzcб)t CpfnEH462Pע1 ml}Vӧ1ڏ#[+O"mW)?,YN "!Ha)'rG8^li4ւ4@IWRyqPAu$qp7U}#dE{f 1}JIs}jQc)w|y^Fy v#܁J3"}Lr7_1~g^ hZģG GhjN6ޫ?Rh  -Alh>p{Ik?T[*1iLMʛ?$DzHA]ȸ3vZT`Jok=n900q:PK.}Ư:SA9;.UZaj2hZ q$~@1Gך!qnvjٚXȃqzdMw8 n>"S8퀜e~[e=^(oؽKE:qC>0bv}+c(x?d-l*yB(H}V.:>g8L9?i?.t7†h^Νz?:7izzݍHW&;+- }055AS]|r|jz8{z e)XّT:[~_L48iW՛H1$qb*2e_ $ݷpgojtaP!]>nkK(黱F&_Ak(b?Vc &>XS.o2ؤP:U a⁆I1DoՇmKy1 SJ3aEtvu7O5iS$c4twf"Ŷ=e{B An=3Muci !j@㛪fUm2k8OՎnh WG$&8Xn{ 2-/}9vo*^.ff[>±@yC'DwrLQN/ЛpO)ůq9w7"餜skJ7{Np/ i7ʷ{{꠰FԐ|y.  :~-a.D AMS CPT&oF _ڙH3>gV=yAV8ÔlvwΏoY%4`"AxOL_Dn)L #430z vj]d4a $-s; -RR=Q˟9B2tQd E귽kV" kjWth2i[5a`R-T0ֲE!N/!v]:r{H8L2=_{;UX 2v7^m 8q?~L+F> [1JK|ϥXcSP8P-aJd6Gie>w)eCY<0(9^|KʨZTFL^ yB;/1QsZ^h@^=|k}%o&PeO bH*ݞr1 o2& [E: :ѢȏJY?HB*^֦t_Q74<\Y4tz(?n fsqVʷ.jO&|=3Z6Ӟw eum\? cg|$-r(eOv8r%S&R;3:z|])K|sش]*QCƆ΀)USJQ|+e!B{VWCcIYs}Y1B# lp a?Xw:>pk8n.+ r `6AKEx'u{آo?g+?= 'I# U(*Ktذ703eqJݽh1G*-jvU(7 vW&ܙEž\g**K$fixǍnc@B%ӳ=~Wy@-RȂ)N5 PT~݄t*bBnv "q`+d/PTxeHT̀gW7cYR_w(D3KN_HTA=>H VϢ̝ȀcLxV^iR&i`® Sg^ fz M5{O'sNЦT%ͫ-O=VM{hMJԦ7&$BȐYmk6zUXLmb~B/&{+f+ڨʬ rnO #DU,M<=O)H;UDoc7r$Yޠ6=oܨP(uY1N T sȩj>fQJU3Ie\Sce[=%3G;5M{}p2ͼ"xxO>(Oݺ] '֯S{'e2|k=O7) @Ik^oP%nu2tZ_1$>ݠ^rh%Cww-:f\<1o0=ܻl6J~ 9U0I)n77OhcEgp% a;Qf:8͒8A:1Ȅ*9&/:w;y%y5|SO~9ռr[T@J(cC ן ]A,|ޕUNwڷ]&}mކS V,4I`>mx1|n $pFV\WçOa+h'Z|mf(gD9j=Ed)QdRq<ڊkfGJVn`˴W 1@;<(}J)J>BZQ[hh*h3uKiY#k3a M{s+ub #mJ0˥]bbK!iQ&1?(s nר_\םO4g90S\9>󍳪@@%/u0~'zc>77|/n#L$­z c+̭l6ݤB0.rr; ƴ+\@0'%}/)Nsדc yBT+`(~_)/_GrI.ְ\kpI>˷ԙnp-|B[Lz{# gX6QetZ vp;E88p6K,8)jfRvVeXo_#6^@byUƹ >M-k X9 %E1|$&]w T+yQ]$UtFFS)2&sʀhbY/s.D"$TUL5y̌!R_E4@ی'jƃ/Pyܧ>5&f?/4j;1fJᮧ#{wƦ,=:%APDB=W5Kb8Փj#dhF_xkkj A$ЈBa &;G*Hr#)"B9̑J%o}4&mVLF1|:Pޗ`yVUcS uTdh{?X*Ih(}&됰ˍk'ڶ[ߔ6bÓgz?>D짘sc,^x=g,zt8Ac|ioH'ƿ H3aе#1O@fcdvVulJοq<֥4#)}f˘/TW֝rf\ 8~[B XotVUh=emX t+ã9(S!T8O:!E !+zp?Z/~L{`+"3|<(R;D0> bƐRVin5$c BHrÈWG<&=#?d'yn;DO BgDtzin<@Tae7ab\S-ƒv[/0Lnw!FF= "e!Dp5)ʊ79$f,#,R) @(&*j, c€&3Nq{Xî+@O_ b]},6}hq p9JJ,=-6ٜ5Z*Sck9SJ 45z7GYh~CY*"8W2RʇiWQwmmH 2LYZw0'XzEN%?c,3 zq/F'_TjA'/KXE9e)I9ӆ?OВN83^;bLq9yV4K }Nn>L F By*5[N#ꏵBL؝ͅŕ2 Jt8}A 0ke>Q}y!_IGu9b12 ^[^֤<A(WJC=g* Eήz )_?Бq.bU\[I)#[F@^G'{纈;Cw)Qv %3]A YB"\W )Y0z{f8Y6 Dˋ4I]x a}KA?֋E$NW7Hjhg:ojD>.Mי ;*Svgz ELXA%!A:yb³W8_w~=N!&@ӕAϒz=d ps~K~ُb /%+p4IiA!' 4l`L72 ?Q6HX4Q@8a-ΟeD_kH)-<(e`5@,w|C͡Vaa_Q00gXN G돔@Exg9Κ~[f8tO>Edf! <6Wp<_A|S \G+-,,N?rf߃:eiA0:O( %hE/6#RIa@`Ȣ;pd+=ֺa|آͧ6+a:.m{ X5 "i|oj 1Gczgzi}V=3jU)ɿ6Vۍ%O*$tZ)6icZ++i9jܮyo3m,%s|foZغ!)KZ"ql8r6i(i<׵С4Gj9/w1[5RŻdd#ͦW)%]s- k J H"6(X kk7d{sNIrʮ}:&ZJtN^gҕԔB-:-랽3WWg bp( %0WӃ޵H Eg~kĔG (qvN#7wriO,vnMlՊ\\d 0\[PU}8%DH3ZyG&μsty_*JaE`X{R=E4)dޠUǡ_b)ịLɏlJP8c:/w#|+ WPʃ+傖sV׻ ؋?8/`Zmy`e>×")_Qvl݂OOEH9}]A3< srvc)w@vr̭] Z >uMoE_Ne$A.2Q#huTgkۉVmB{lM۷pt)DO/DUWʷ >$LCRIV܄6G 8WD_)][?&K>}2f#h',O*c8,kiñAva+PMw3y{s QeƲ]DqdF#Q'^[1by}Zת '[ec rQ}}H,$j7 4 wnOA2梌X}R|aZ6 \X^v) _S5`JY Qis6]!rwpwʌT3~ o(Z˄G |+ ѕN!c.ڢM=I?Rh[5BheCfl[^iC1}!m@MkFqdB5GFbTY^kR2y[鐈Fh$e  ˊaw>aXOb0yh0ywƩ .m *DH3#t)ΰ/r{r^E%Ofw*xةL%Dtqאtnkim̃vO73ćӮh1:5T'zQU}6MD%IuAЎM~m]"jWAfis2{64͸ c;)8VX(>7 >GYExj RKdկ+LVͽjB>z").8j9*E_ koLb5Xív*s#~oRdcQE_zHsqncݾ z03@';˕T^T+q\}#"E4UH/ 'ZhPy-KkALZLi0$` &z;BA};`f[R.|X!4S-^",n WR LT0α@C9CyԤ9m٭ @]AO3O7jD70S$|WɦdH1. Cs[E*[o\2Hi;jK@#k{)2x>DR?Sčq|*u%2ƾՁ&`!&.ZP&7ەWB[{G]$y{0Ҩ6ru9NJ` kzcObz|R(K򃚩$x~@8Kz|>oq=qU8_"J .#-`Xsoy~(x=NYƏۅЊF7墤gMhmD)@0󭎯I`eAܬ(sU"Le(Dz؇&¨VC&V s,vd!Bm z |V&vr4R-Bݺ VI6{a{TrM@Y0F2H('2hy'vw'w/)6&"0M~I _aDa#WHrpk߀bL RM*[lƮJhzP^?<siי Mt '[gR脓yy&C# ̸hCa !1\ng GĶҩjSr]=rjqC!P4W{&'UwWח)mRvH얨v+ sniD'涻3~ܿiw#ʠAۅM}/|ߧTɘU`1'ӨFe!D+W: 0NjwAp賒vV)KpР\%1Ւ`p֫c͕ OF@_Iuo6}J|s9Q$d dl7V$Pa~g``ȖM`rF!<~E7Fr.+E"% $`CL.VG ,IR{<2ex>x!>i\!=.Bj"X )=ҡ(aq~*RٟJI^/fWS-{ yYY3 /LQ?Y8m!ꛠ2wwgV%:6Hج< Lkſ*B#G:ŢS4;\x[wBKԫ} ^AhvE:~ɖZٽФ\[: Xe[Fgb GpT=]eus"# w<*`Eѫ؞3U6km eeVqNѵW/Un[|70 hhm}BYaefiK+ˆkFg/82l/iƑNejHQ-~cОvl et>ʀcL52! SG7BL.L\ +lt]bw>_c;ܸذ) 8kO~ޓ jwmE9RNgޓž$C)O0B/rE9j M>L[5t,wI5Oէ5s|W f[tq)fƱ|fftZs^Ǹ YF{M{¹pp$1F9-QЏL}}f[\}S}N6*$#S=Uj/L|6GԱ!/9'Mat-ҫ6-St(Uh=v-} `_ GB!icf/PE} erQ y* +2d9F"^pg\.u(dsE#', AE0^qYv|>mřJ+j;>cf)nuʚ$vT9mr&eˤ;{rTݲ \>n'e c?Kkj9rO;Zܔ;Yghe^jy.28Y2Q"g R-aj#Zvq͕r0v$Qk2{lco~`bUF^ ݱm{e 3S Vnd;CziO۰@Ƀ"QxT[c45fYr'X芵m z.y_!IŻ~+ =*޼t% ? ӈ yԢcWwTi;kcv GF@h4ԍF.i>RC@BN ɞ%RTWdS='];SLS7zTze|FCкJGΫk{s`[<AN :3BA'x'4yea}TQv`cMsS-(kMe[P~9~E#Q{0"eB Cm=S$`5@Vls"&M5y#FfvS}eT XlʦkRXotqK<~Rw Uf~zh]f":TŶ#0c,{M%TXB ]=n8nklـ7'  mqGRpWn9:m&R,pjT[k3̥ YbEN:@$3d8 {(*N?CXsD%}ƞC)"}Q-@xfmc OGe'Y56*|$r_ΘJԆlbKw>^Ӕ( ;u' EN;*d}uDBXv{sH4WɧZ̥(7Ŭ}"ɦ-ݟӳORzMoI ޡ&TKR]R1XED̩ZrR̶?LEcQ2r&.$1A;xD\'Ib1ЃpI V^kJFZ]`:3̍_AApR2Ӳ6:}LjǼ "u+rv/[eD'r݌wTROlVmTzS hp#_0M*(ayu@g`I 9F ?bst3j3yW$l$e` BgnW@`չ}Tȕ͂@A^YmWbCo/,~AVNI/W%Я258CCg6nDmȖ~@0j:~E 3])H~ILlK=O@K;5 4+T(NEquk%GTٽ+Oyʢd藞&zs% %IQ0?͟>%t$m|y^~rjVB/^R>QmTH= 6xmӫ+$0QŌzI()[#'? G^RѸaS{b5͛;Qy֛:aҾFN<_מi7OmU lښ>nွ tX6+<{ ٿ$ g=D!HyzE7ce0 PXC mp1Nr.]gؿf& ΂ŧ^?FcɋO6}Ϻ1TDbdP uA!p<3𨙘*քfei9Ka),ng a̛'>[Rz0P&.` "guG)Nxi6 HS%\d_Gݓ~e_t08,PvnZOt]hQKyI.h"t<+ ;Y>% vP.% ›&)1m_ȹ)]= K'%ܴSI HPPe_T9d㤕x(wxC7oFW?EFdmLغs2 qIY8--{²!wb aXg4zBWA=l2dwl'Zk^6qR:HUۡ@k'@*zNOKO?jODr\ԋ(RXޖ67jYJ'lw!I"c NCafE\5Ӭ\ F0K! k5T-B|DH^_PFZ[ /Z;T| ޿z8 aH o9һ [RڠS?鉟] 3]]_)J7kH!,;1M c| {>߄wGja:<FOw*70+(EaIdGq'<ҟ #/;+,k8 A)aRoWm2erye-bV- OdLPk߻趣BTV{o?JXt$ P{:Ywg)}UUӅדOA8X6q G)#WV8R{?K|+*_%x$ J%)#Cjy~ ys1"%btp&^)7@%d!FؑMШƇOh̡=KjsCk~I=ʃ[12LL/.<? ݔ?a5Yhi2 gRQ)"; _lni͛'`:05-Y6%RjuyI|wAĥl${_IZ_Z}Kpe9gT).^08k ҇%˷k *RR5- +NsЗ}xP5\ i' b5S`[% 8*jIP;V1?l&~|omЈbhdѥ bncKXV"=O[}fLPX8N6xjɚ[ς*6P`(GL~{M˯o!JtpZtQ8zr6 }ȂP_wyln`%`d,6BJWf9P~| ('~IYxa,(DI{~t,B 0`W :n|sA竺m艒ɪMFPD0d d 4U·@TZlE5оRg9u:f[ /x[s9VDy'k%",= c`Z\`RZ8pRw5A3J]Jef:\[Rxrj}yúY y_!cx59O^y8=)܌E0m YDhŹA*n~k-|4H20C_{0Hqrc*h]t}Q;?>!PutȪ'Ne@M:MPa*W Z]: Bg;?Wi\G?EWň285"[$naj;.j> bg-B]{'=-^F3ֶyZXzi0aI"wk1<[ϡxO x3.xC3ΐ!{If~eC&cfy.`GA^5E2v>SnSnf'&wn yt`*n.: \e6⌣&FPP8Lva.M:C% (k $%1A>Q8J'~3*5ͧ BאEz_,aapo.L7fO`1xqߖRX̬nϲSid+dU0:|̔-=q=Vk,,X9a[8[*TLH񬸠M7 H0--wI-h\H2ݺfLEkTU[&VRp&aClO_ױ6^ݰ,ajԱ_IKl96@ &q4&d{<}]''{7LIar& f#]]M^(A035ȁͺ]빌B߿if#YŮl_ 8 da GJImKQ~Ϙ"]$m0[ܧE#v~L곤O^Y\vd&ZOk1d\שQ(J0YkV|yȟ)pHTb`xXfoR^"4*̓÷^c\| I{+` wˑdIfN1k)\T%硇'x‰#8 6PShhP,IYK5lB2 _x W(" ڰvJ5_dnzBN4sc#=ns=tơVrdѸ!BsU0*kОsTi{?Uk}n12܈OmҀ(, 5,[cAz/6$`7v,XE \H5,]kO cqX'jb;;W\'Dm|g!tuj<4؀U(p?h]87S7.-#4;D~O p) @R=4 7L%SB!,LʏP3sdC#=)'/C!ى?Ocَ2=jGS$'ށDR<\h $&x;~6&lwO]Ax]E0(mܜ 2QLs„Zca! 3c(We5I}+n3qt6zح姮ѱA;7܌/w-b.Km3eSJ7Itu 'pÈ7BnR<~ xbo;4bQ05.>2oՙo}|X/Ød0`xrP+(GQ_ʓ.LՔrԃ t M9yEiCn-#i)"Vck0^H|2e iB꛽$' 58:v|6@YkXdq/Q}nvYp{]!ndtT!hsL : [+ޒ .~!~,W д'gH 5̏ \R؞4 sჄ+4Eˡ,!Y8l67==ue@2B95{hku! KIN0Q߃BkMZ|( lEhAatZwd"r {@M3gbz? RVgg堝 1fe{U鉧ɈnΕ/} &Bԍ GlPOT챢AQN/l ^91xN&ecn%\c>zd;&I`9`;!Dz-iWܰqR^կ^O3/ύf =qni3[cOҋJ^[|T-Q(~?ς  zx މl-;1M^mY|+€\]}\$ۙFX¥iZH~r_Hc&pc@a#RY[Qi.vExـ8ܠ|lPJYGS[#P=ꝡ*۴{A Ɔҍ'D+ʙD41xjޏ*Sh-OW*E19z[h:[X!(J+Bcf.EyӸ L WUwzzkMEX/ӫ5heiW#"⑉.L}O;p0(^\9BBff"CGU=ͮh5}7YѥU6h [P,S6 8c VY;.yN)SZe(I7o/lN.MWvHJgG)8p{~lI;c@L[q4̯`Ì.dQ`BD7,\Gc=_} b<bkɭoT`y 6wy-cT|#ḛ}NԄ;{ 0]H/֖o]~Ò>aoP ZUu!}.<'p`Je|ș`h&JxXea(5'bƁa*itҪ2%1 @<-zmRnUKEgTP) 9c]T7x(v K粎.<=%.+ 9!{z[5Uk=!ʳ6!(/3Qa1tϡv^1{w0VT'\|*Fѳ;HW2zNJuق'~j :dD%g:qBw4) wj_Wh)ƔNUkUcC}]O*֙n W_˓PqqE^CZ {SC6>IJ|K|,AQjYWGp8az> VOڌ [[2 HM }Z#]SUV%rOpczHOk :UW[ոB@`<;2R>2v9d?ҁA]jv0>LTe`~ ?<^鑍   !]{X4Ľ_0>"1'GxD\Aۺ[`wWYN"A+efȐ~X~ 4f~Ev%U%ތ)y΍b)hwZKߠs_I-f=@ڈSaT%ݶdIw3ᒖ+B1F:8zKT}@È6 g{A%G kC8Vw*"9oE6LA[:S|*ȭD4W-W?4 f"17 /YOhLX1cejbQKYbV3IEIAb؎ݬ;G za-Xl &KLi :rAl;h-h14!i{+y $s Fy4>:Lڲp.e~r[)8AC.6H%Lk.4BOʓ^/=|RNWq gQb/HܘԴ%>; b܇[t Y4 Oz'o.+{7ڒul*qB.멻ZJs8xL&pN?=QD(`54:'Jkf 6Z,Vuif=A3Nd/ {pB)sȺx4 CްF6j.6.x?sygP!Pp PQ:F~4~I22B6Š.%~vgqBjGɯ|kR5\s~8kQ`~nE_4QKDbʇ1ڳ۔]J +e%m1 p9NYwV9xUW6B^%ʾ*k Sׄ&B +R/FG'k ݞ\فb#@ _Dd KJoDJV;N>m=v]}ߝWs :+aw|^.O\zwy M")GgO,<ٕȲ P!8ۊp~Uj' ^1v|f **o %䎰Q y+Sm[˧a@ł6xPRX[&4h™]BdC0=QK\Ʀ9fO*n9}P]HڗOңV8QpZ'XBhn5X#u{5ޯk w˱Jv*[K>HRm38Q:9TiWnS1CIФ rnu]-/n1@s9Ȼp/Cn4_Yv1B+Y_ }v[: |\*U KFGrӠ7ڍw;evs{-*AڕRk(B&hI~1꒣4+"ro]W$o2Oj>8 D$FJtN!Ce( Ɠ@mMfߤ7KO}ؔo?ףX:W9+VֳttK30U{ؒ'6Ź:C!pxZCFy0|JoDl?Y Ȅ cXi\sE8B`@q,<݇gZ:%\f2Z HB>3z69 vR7$:AE1ؙo)wRPIq9-‰9yl[xʗ'Q'z@^L 4\{|g js; V2P)^$o$UM^7 7yM?P~z39OjΔU`糒:3\lx$yP낙*ބ'w" `)G~+W~J8Im|Vy`^327C_rƠrKB"1^{ދRO̊!$Fd\U'4DeA{fp -^kÈ[%Ӛ/G7Ƨڬ] :/ 5N=4ѾF F؎A,`8IT>i]rS!(CYZ7}3NU"[}Y>zvDt(x; w$vw_|Kq7-ÛyJ'ʜ4{5RBMF:5~~! ~вĮ{אjwX& \^ǰ.^=I⣻ܮmc$H&oJU*^澭5Zoq ~8Ց qm'o!Y}=چğ Z @p"!RP`Zo\evG2mn$3WgHwd \7(nzTNL%yGr3:=Ql[]Rd 4ꏌ pj鶪+LLz>dQq&?4t#yL]r+:P%U5B}>Y ]E-xn)u?ECPs姗 AD:MWYԩK@tSoB YҔq=(a){*q2ҶbTtv?؏5l-U/Jikkw.G7Vc7I5M+{SAɰRՉ=yIcSZ%wǰ/*k$ BŦn.PKf\@ERb0#Cg-@j.rtbۑXu EˉV@PNћk4"7T#}숗5ѩ`Z{<4A BJy qOکDx3%H,hy$z؇w\E ]=YBؠ-@_ak!kPQYc2D6ɽCj =a,#%bx91nA1Y`U}/uMqcIaeEPp7Ɂ9wlRw֐Rz<'-79?BǍV1qC̴& MC .Ľ;ܝ`fI31}7J2 ȴCJİNA7?:M `DOJy>qo/CYP>hHW2sFAPGL ߉dҝ1.p߼-\ΨH 󐌵rD@AtW|׽& zcގܛ82@9m 0Ty+k ?ݪ*F\N}E>!bđ)!H@qb#j2+F#y3M)3z!ÆpOXݼ*~r6ƦRmWWCl_ ]oD }|__+PaˈM{+`3+n5Qk:BnOjKLKjaZ;qod$-@w!O0^( -q~')ԋSV}{g2AŒ=9&pVD]27-dD +I1nCpcOuƁUUFa7}+#1*j֘%cOmq݃/+(9R[t&/|)t}L G~7 ~5!̰yfjOGa` ]׋?k3 aaȿ&ǡ ڥ.5]Z=J/^_4fkv1_uP(;،Pʎ ]ِDt҂ROń8'iJ`~+GpǴM-T5,YtVi2BTXie7ao'S^MF"Ո=T}n%e$34XtےSᢹnr|Zv4(vk*50dcB)1ﷲYN4y> X]|MrtORt-/"T?Ѫ=C~l»8<#-oЬNtӰD2ݏRR;0lA73_H%OȞӗ.cq_[CE|>X=DIO?9 |(7%sOTNt0URQ'ߟ*'.aAh_Q zMxRheku eFE u^GlNnPzZ\W#UDc=6 cO>A@Stߓ&=rå/O,\@գ ;t~jO鮰.6; 3WdvJ > 5+yZΣk 3V,]ܶ@u2` @넂_UT;O>!abѷN?З) Lk"T.c㧏a{jCuw޶<`_Z`v^MvQoJs<hh<{Z)AJ~M'e+/[nPȌ8P': ,YD GZT+\?:e6(X 2A h^Rk?A; Oqiy_H}fF1v eqx+!W׍5SZpeNJ)7 YZUQt7lH8cX |S%$b|uE݉WvI93,jG#TCkt&v+y3X;L{-qs䭁1{Q/8 cOͽ+X?Qw\]aU"BG~|m8r+{DRȓ隐_ &*"8C'c9SHgGYnnAg8mo1L?#&5* yhlіƣDO{Ow!:a=.9Lx"QTQ>E:ϱd=<3bg&!dHPXn*/ ꨄwI%&<C D;GO,vU?xON0Nlj__'+@Tq~Gfd['FSՊw;cl{0EIy[?/dpVH -:3JP>^8qpH w b_,9/a^-.y<ooG+p DRQfGHr3`J+cfh 9Z^=n(lŏ1p92@~"CAl* {r,DSY#o?k4_]Va6ޭDЭV.Kprx24[O-(&P!ҋMx &,$3ot͇S<ɳo5+#3g(=jT /oB[!1؎V{V_ة;A B?`.P\/*E0,MEph@Hpžư-팵AffiδOh~`ǯ6LDhJޙ1 xK Kwg &xd%&',nLuDz piW7I B..PajY%dRڽ'־?$FKa Nh9u\T5`DD2o-kFaծ?Xu~rH9&Z=BѴ?PiH7當` ě4La,O-jAIpάi^66_l%7 Gy0YiW }zP}×w*vO wWum.:?aXy3Hi}ʍ*PP9l }PĞ!(I| ,e༸&.ER;{!Y`Z4N;yPIU|cQ}@q*|`$J?|lwGY۹N Kk/L76 tCM,sh ^5KC?$p- f_RsG/FUc]\֤N.[&Rs; ۤF{:3eG ߺ>u$b88qSMĭ+=[y1S^_n(S72^XQrH%Jdь ΰVOlK?]9 vFZoeHH!2 Kρ-PI@ iu-r/c<0-`/3+9GvGx;EZUGjbg8ͪZߪIqL^4%)f8S]w3)VnĪ{3q+V 3|ۃ='pG#8Dި*BJ}ߝر,{ !n~a$s^^ޥ/b-İ9&XQ[O x743V,, ,Z).r_2=`1wȠ p+*{>nnmuZ&QzSiB6t-F`F5ԗ4imӥXBxǾ*|| Lړ/Jix"Luޫä>3NMoU Y-vw靁ڌr{d5 >meث"Z[O9EṔ 7YX^4Pbe# 8/iH3xe(n:lLF83,Qy+05/J/eT,IC<"Pec[or蜲HocA[rWܵ"IP'/ yp 0RtzP#f|Ϥ*92a^g- f9I]]WyVanI0$sg9˰+pɰlt}׌##{~Ma@YN9^kup4EX@ĪJ=[!u>+@>BPl\yIIF$H (s!&/S ʴtJw+z޹BZJp k Beg| PTfo#≠q)]]sIbHu<&A<~MjB{#zſ е\4!{1!; @KUT}bCvW%E%z~(e=)btxs&}M cZXu23,hb4_6<О/貼- g kkR+ 5mzb˵=2SoucӤt{@Jxoxvdf7J&tVNmݰ.wh ܋!z%b$}=G[{LYj AFI}Q=M!HHp?`3>O4x' B!B=>wϛ*L;/3 7T)h5`/ rhg1 вÏHFPMH*H&IKޑCqj$ $&{)3C鋟YVX8Td*Ftwk\koPٮQ?>xOłf<#2PŎ_-f$Z{>,S^Bt{OӷQhY̱| SVц2B lJcnkvy^DlKtkKݜ_~oBp[F#EHpMiV1>Gtvk˦t?7pY;ғW"'QBhβ^; c,cp8}RƄ*|ܕ”%R8ĻY+Nnf}Xe \!)pr9 3TAsPhדh1փ=jLWutCƏ۞a8UeI֥ eb :yY9 .;:F:{̜,T]"ev}j2V~^ { r6toeK!ڇ Bŭ)|kUc67N4G +is p u7 c8:9f _RiRQŗ(j:@"/ɚ?+-&S+ι).""d aI!un5%p`uZfnt LՁ2Z*^ysN҆-)M;<R;CͰcj!DGr}ic<5{wqfw.fE 匇xZ;ܰ%8!"SgmT叵[;$(þ[wΕrqqfx*Ҕs(U[u0${yL N`aLlUvP1N\C@!(z.˾0[VLAʍC *\~=L.6D~9'!W9xīAEZ!Nim-0IT&CpF98A_:/4ŠOǠʡ陨(ؼ"J'^J=l# &;$sh 2'YR[E/zmvkC݋KAiP CǎeDu1On8Eum(e jI<kLFBg<u %qus$hXs#A6iDiE;v'pRQ}K7qiՔeA^dO ''lb(ŗ@5]1c?ɜh `Ŗ-7tw}RNzl?!]Bs>(1f|\Vwe|:U),>0rfg'!:F(㼺LIXBw7R!5va+SߑgfdHg [%L޵Xq:1$I{v«1N=XKw`2 o{#m43&n$e,DPOnmZx,`_]s:Kbs[',ƿ,Oc8<ڢ@qֻ ^mAȅeDsڍ3F[a J珓K0,M$Nv sbB!a`:N`ka8Ko*'d73DɇjatQay=rt*<.^tTFYѻ˾}BDܻf~$xn+ 75V]X>;-V10yC`К6^N磊xEK$2OK%C&%  D,^x#P-劥Dc/Y I f YW$AQ-̱lPdKdcXlV47=kx%MY`yQ[䉚ʪ aJXanZqn㔾1l)Wɒb>#C?R"?~T'4]\d&Ft˂beiq9ƭ'#!tX6WcO>{N] Z7H9+0wOfY8PKz&A_@vrؿh04bSyhr98TERZZ |Һ7oE}7LJHt,Ӯ˥T^o=J@(( °[:*fa-ʅUl! 6(8iPwrX0p\Z0(pxL› */;:qmkm9O_4pd/"JO%r!ޠgg(C BO yK1EPhXTctfۃ؋l!6&6_ 豑UxNe:LGvQ/=z]/9a j(ajC n(V)IHX/-l Jgew4J(:1ԍg zu"FjV*:CtjzSs9^8 m`!2JEëo6Cצ mE]'J^{iF,oS-'pGF7$b37Lȫ<Ǝ-||Fx<b !VkQ #_#_Y[!9"AEJQ\EV^!hԁQUO -ۚL-8j S!ʦwP'l5Dk&D$IBV [xQ}a٫}) =PnI8T]/jJ6]lȏth4>D:9R rsXVH奢*庋n[69]9Q':{:1VQSq6Ў*8IGHO.5ɽ=ƋLw;3;;(3s~[ Sׇ˞H :'ym1Vf&pFnπdY%Ӿ-c\73Hcؿ#Q )#]:- c%g| Y>s /g~\A:ٛvR2(4z y4>MꝽ͋Iu1]7 ( Ja*/VS#V 2(kF l̡PeN.q@, (|[TmI΢6X}en^"#7ݘK&d Б^; z,U-$wh]&550+_L 'вƊ(Hl!·Ǽ;عh`N =$FjWi;H"hKJr:8)SDQxz(wk"Rrdw&#[zQ#rq~3"E0KJEml4Q!Nv.JLsֳU" LmZ&;džI 8v?ߜ} 1T| H=4R|6XႥBEN8)NPyVU>#Cc POaeLanYTq5"?nfV3HHjH ۠di+=>N*%Vm"t`!d 5U!-Q;+ȑ/{AK84|@ָ';8YU"Gƴ-2><w_ǨQI@)P0To-T>#9opEBmly(lvVfqOip)1&;sO 8zQK2"*lt#r{5f$9CrhҜMEΏ~ ƍ?T1i' \Op& &:V\dét_IH82xH}f){g4nuLTbHC$Ygu1u;-OY|rvx@b+$d?< )>7Zo|&$9vO0O(zᦴ c6q~%҉s_v#,]>M;' 魟Eyi\HZ$~3ʚ_=~xjk3 }1LF(bMPcvRIx%n9Pc%{dꞶHf%9CuD #PՉo; l{h&qgLx]ٺ|JB-*zsr..QGaPTx4F$so@V Tv~yTFGNC3 qUa!d&Ɲ# js/BS [X׆3Xg0<JJ5 5M}UJR6pC_Hzi q#UkŚO\tx` \X=Dh}D}!QL=Ek=Q1.Y-^+)k o\`M;%@Efk`6:첑R'A,xёķAϊn0.-z\|6jg_"e_¤@Bq$JZhm0(Y>X.t5}OchFm q4vd]xO!dRh>R;9{9]6N\ߧA%!ޞ:YY6199GcTftő򇭃] %)j ;h@ CWƂBR𠩇00,K $/j/`ˈp?Jd|%q[Ѓ1O?G'r5c3X OJWr2yƷ4LI!:Z,|yPKtj+ w |P3ֻ@yiYrKkTrW]HC"LXڤjVTA*iNjݲH0Ezb;6#v,ZKp`6@Hܘx ܌^z}rnr ,ΒWpBuU SS Ĵ!ٵX4W _?•r=3b ʻ߼x]@E`p:8!?n6xŽ\s#)xטchSΪ\RJw)ց)2u݈n6#gM'"֭j28gZ{ ,]ϿL!x}m K-u>ayHa]na,Kjm_eؕsH*ž{',V>%x2 )k:_͑E)/'s|B=h9R0'_FpSfn6KNK ??}"޶+IL[ΈU(Ri #ɛIһh <r+#?xʚ {Νwޜ< $\cIDBU&*`t]"BM ⥇ܕCG SX[ׁ 6yڃjtԻN.~eYω@@KiF JR,MMFN}t0by{',!Vt՗H./:)Εip?dD}U/4- ;@֒_ MRn⨆LPXK寉#Dpo݅hl~; ;Q<s2~dvu_`pmN$b1JVf Ȫ{컶։XryKX}P}[#DiզsI&rt7UUE( 3lߗ4H}N0 !>65(][hW{<'k߈ߎCYk.j<_ŨǣTrxX۬W'D&/7u_n9fe\5l0_12L*ҨL8Ջ"P}ocw<i`ω~K"?? ޵ʚ @%Pw& GcX.'!vs9;냡mOq_+uYfT Leu^oz<eO{U~;iNLNE`a%M`jP-Tj3:N3T9ja2]ѱsYN l?YU.&sG : xGR3l0wN:MT'FZoD%|V:*gm]d(4'RdƑQn}Bv%w%X/$' (ne:όs8RMWd޴H-[O$bS:>Ђֲ\dr {LJHqF6rJolx&`lBs3/V¡=K^C *}9GX'SAHYndyHuN8d_^@|u&5Z7{1 9; 0>g}ʍV۫J[avaia-Ъi9~дVI37mÛ)cAz8GL%%_cձb@laIf39}s΋b'CwIWRcu \x*;AxC ;E ]{ BqPEBs܆‘q ^j{y C[[ڪ#Z9ٺD w{yFtÐ?}"u7.5{*s䌻U}Xc0X?ߝ+]?O*0ԁQTZ@4^U0al;yQAn!;A412yKCL(Ȩͅ@5P|Ps$[plN )oז@,a3lb6B3GdJ0خ*{F<UJha=-Rq퍮hT;o#q%s8QPl[DGDL4,Wr5Vdn@|ڬg?{촷m%r>+_+{ˠ:#. /h~%@בr6X:x@pFI@2V:ӹV r]zv:0xb@iQ"KOW8Ň0T 5Zf3.""De3٣2Ho4$ov+˯[ZTng'2H?kCqips*B>z+%9zhh]{Ӝ]}PC"e8٤n4;>D G(knkӃ?]ݎem5v@aE|(e"B ~yuC M>Ku@'x>_yikg9pQ8U +43]!V_q86r֯yל!X='wJ֘7!6G>%WȨBȴ  +)Fn&|8oBtr6f_$E+(!s%]=b[؁К|Fkbc@{Tժw;)Γccu{H9҉"zi - Á1K0m^1EE Gj4?VsUΌAvvKFUP't"J3dM7m  ;ά RwNL'3s$L;9r!COnKSHNir-o7_Җn0_ ZN3U%mVVu7!(#Y6MNxFGUKv#P\]"Lx᫳ǥ^=d@d)78&4CV0!Ia2lʸf!Ir.s=bo?<&m?xY~,KWEo\dEs"jM|(ڋey W@7k[[e\fjHq"F]U,-Mgj{9\-&?g:̢"7NCoش?ʲ yRSb5BB)r={1^avgB,ɈBu ,WR?sUlI=^i1@eDZIn.s7"GH Ux,Zo3?EAM.|!ICӰ͆'@c<*tᙏ5"pPUKS Gk.uIpg2C[c1FMM!^9XWa%KZ q0Tܴ8]7b -eF.ƫ>++QiMx`bJ#xbGzkTsl й-&ʁmsIR$U\8{ tsg ƟBuz UfZ䨂qI U~~gf*pS>P'ƽљw/=X֒1?Ak"08 UK6:s+gPnv&5XPY7B_Xmd3SB1}3G4 $u; g W~*|)4LpNn咆"6Zڐl]}6U?b0&618 xHhF>wH8?>T+n~?V%aKiaRIÏrB#Y HJE V2M(HUL4)i tr1W Qw˰dPSb PFl0xHJ{@7=F?=i*5ڛ.kDD&rNMp#6J!]1#"U 7-J|Cp>.iduDj {YtXPt.ѼyN( (;k5iRO'+Vc)k:"1bFVnm 9/f=l^rKDŽ _BǎZEuv5~ { .EmT;y ~&w`+m-;k3dXadkל_:Eә.,]8ȕg47KMGɒKx %%VK(]kY&4 6Fk&8T_b je'̋Wfk^EkU0!]T TCdʩ M+O /5gW&˜` ܚҜB$JZ"h:[ õtm ja >nl͡ >Yڡ!Ov m*ۆkrJԾFBdln;u1*aZn+=UC;M|nRQU>rK.x1@L3Wϒ˽z7IoҒGx Ts0ݳ_NOȦ M86MZ>d1zbcӊ%;4_&Ȉ&÷fͻ,׀crr ܎gC|B'q$]G^LC#j5U/qd=I<-Ynnz)Bos ,RD7h=w;7|,Kv}Er?n߈r&(=pnG5b]Bn]y[q*wcI+@Oph)!\LK$wh;akzMyn3t>Nf-#p]cN쒔{FAg8BU"ahc Β)CV^ج~#?P^V xt@mbT[ܯ"V*ÙSpC$XRfӥw3yNܟ(,J'[Q:0y#Ӎe2ܵaf=IF[{fL#! /OK]ŋtGj8d0S%kX9`#[_'l*5E1u '+ɰK+au#=mﹷ` loߑpJM#]@¸mݠS##IFPAiGpPvmg]fJ筏y4Csp'+i|V?5M}HW9:$A!8v~o Qu7[?_AϞȔA?oq@J xstb&7gXn>4n1oIJC\:=M^ߖA<^.kym\ƈ_= PcGP&/[SFg;ɩiC3 _pZhyUQ$U3'wro?jINzcVtPSDQaa O-۶+~b}9X}̤][ܺ-Q2?T Du+[OͯhN}V" fq!lnX; ;ʝNށo(9'(1g,KfI`.Ė(N&'+ic-{kz#>CX@7[%*`%zCR˳e\*3ZL%ʲYfv4D?`=ð{h`42^}/7J!6TRg$/HGT^3;?)q^q5 μ S!0{v@ Wn Avg@ <)mT" +s.f?cAg+V9"h F bn:O}mVvG[Q-e&NPh׏?pXpM.GY!oǚ< ]nRcvNW \TAOD K+EԣKt0GNpB$X,Oy &k/AqxB~? 1XId]jEt)P6klIrvшNT݇˼&qt b2[e[vq#֠hgIs>=M {R?\ )gc:m^{`>G`FxuL&Z?Hx:16n6v:R{vЂ7 i$s Ѷ\K5KxGZ(? by`oxWOK^gnژp!Fe!9$0g3 p8 m3ʆf-%lB, )1~02-9}1͛ʆX߲zQ4[b'hRaq~̡}uӢ,7^ioQe$0Ϭ(TaG%f/2wh#?n p+ ezkQ6:Bu#(#P:t}<$6|'D6R{ng848!7#֝ bYd5U 'A\l2U_ s>_.YIxp.>?EhҮ9Mos:s)#cG QC˛kB.Io̽)38 gk%|d<%D|tRLIޝWݜ>nzaخ˅i%}fTBw=,^o5d8_# iܓR[]Ww) egVe#+H'Dv /v#\D;ֽ5Hf]antf|D V>^4UU( ٌ0p(uCy#e5}AQJ!er@Q?B ~[VnlwLy)zS|GTQT xc?Nsߺρ̹[~59E"4kB>+I;lr2yHs^x%I|9͹$]+P4xCL/%`NYൠ橑3"9r9;ҷdkV˥M rz :5na$e<3).qvMywRՐS<@V # `?kݝǍuy NjjK@: J~ON맚"!ػpλLf)_ּE h@pO2j7e'b)0U OIULVð'fp>xmX<{Y-g8iO\8\LA1CɝK 7X4GSGsޚ Zf&x_u&@oTf7ܤ[C wm7.,3tHSA[H[42M5{dC2^[X`B>TCnWPfΝS$ׂyVT?5Mdt֏q˽✌{CQ-gf4:tO%{gyH:ysqS5`h#rBZ?h.\vY-DP⌍h5+ !T͖V>2Yf5=޾~*Ln'c/A8LN\6 KI9~yJ.^Qb)%ZvrswY(?jߢiB,81i'cJNJŇ i~Mݖش||8'U15ʫi80mf {>a''sGO{\ΙKMqm?q 5:pbxI-Tup}^𩓌L~.w:I9]VK BzoK1jo(lxoWE0\R[yl{sA+8 R%p՞Kz RPLu~'3^}``XFR0GEjЂh0CP'??_UKI6HMW)Oc6ROG{% |RuDi<.˵M kM<}dIxGJt*(l$5)lt@yd QJǸ#BڦuNy't ԌQ ݹNFvtM);l:L1\1y{%˽:h'T|o#Q` ?Xh<Ikbgxvӧ&KM.@a]@VnuT*wRaz7HIgvA sqm'#Id|+nZcn5yO8m(xJ!g~DPGPGFsv{,96"*{AVfh8LI5 ׁ6 *BG1D8<٠>5A"e.i[ۖY:,^@=NYs],FnPeQ"k<:4ODRޮC~`",E8equSLY)bW3HI.zc? ,29ݏ~D8~WujQSQxh񊜓@Jr+7O;*\0 :CJK_Vʤ~Afognw3lDp p/)Ɲu`  O KVzt < w؆& 3!##bi#+Qw}u _Gz;׹ʛK n?f(]D՛~f(i6` ЬpšHXf+z:1?U~;q T}4o"o#+o,g|@*Mo}c1ub_{m/"dH(fhX<"^kj.fyD[sϋ672]*-ȓyĎ0U⽉7QD$o²Z]QNTӊ׫V?bf0Vj0<*@hP< Ր}xsVlp3`9&tGm%Ǔ9iա鵀Cp` b7ٝ\'W]UAҌòO-k 9;fB˧8ˣ}Wʶb?*1M`XZo2n1 [7kwh*y?i&vfG" Z><ĺ$FGֻ؞P: .z[nJA~?CD {umt6S'N `~Go~翏,:UL{_|H@jtvXܲd%[;J}`/E™*x;a6<p޽VΤ*N _t8xQiOo&(w2@T3D4NZ@hf^|WJ ʛ;@#:CE?Ky4>ĝc n٪Y.҄n4f`4I=hEYi"4UUYuEIN9@81=nykbt_3h?"fIQR<z ICNEꍹW#϶,8Mkgt^xЉ>DWZ PNG)92jL(rtdjLWP}kCh//'usQ`C#$t)?b1ߋva]kqur=Y@vX֥?7W0gs ̹o3F=C2H"?OVW(hݜD4L<+鹠r!},@."-8BDk8,Z;[ L>wVtu-P6=ģI`ZC,{EFrqyK bMp~@qմDv2({o`ڠ>m̊Z.ԮeI>VC59p0 O% !a96@WrCK/ kE"'GY8 EaY$jbY jl1\F ~vTR 4/ E/sm᾽Wm0ʹz2/w*Z$LGb>Yo)~&#jR?&ar&$+}6?Xt Zst956үG0eyzRV+T Tqcr@{`.25鳚0>\1㝫İ [ jENj9R<"&Az vay,SAmձBRqܒGrkZy;º=IR@$$4 $pBD`9en<|VY3A`}[L5,-.6^~Ȓw&i`AzH`Ԏ=r O/3pv*_֟D[q8;NFc@$oeKt~ +Z$w\GBF-+%t^JIA/hB먺I'VRt[sU5{iHUzU򬃳d yQfDBTv_!*$*YM28M[XWVO^+WpiZTz|ؑT={H  TET4 $SؑW 9(|^sb /HHCT~1P*rthbqHU͒Fe!+}ӻelk]g*2%?%oc[#}7-jr0<zqF>&~BzLL6FIIpGYWRF_CLGAB!B.Dz#lz r*hZ"*4 s&è.: i!D@savstVďw7F5hr:fI!鰋v"^#W/2-6/?6j=tco]av[ _pC2to--{4YoqmfkӶ1/_NBې*Ap/m͎v E92?b&EH)8atMW%/+$ ut l=Jb _SZ@i24 \6F,kB^ tc&dmT~;6x.`>PNWtIccq2WH+ cXȬ!y e^;hfPZTA~b&O/k+`a/W;7E>ɖ+>D^*ؤߋf4@aņKmj^ӒX;[]ÓlƏ##}gb27F"2c d)<\Ms;(̬F5HBJާ)T7hlRa.ŕYJs:԰w:y@8o;⍡ūyT5TJ &=fn&:jm@q r= ;.EF\03M0d 囱&Q=Pw –9f?X)κU|Euއ+ⵙ n\iA ӌB Ւ-|}ـ{/'j@3ܾ+%k.gxOp+ۃG>>0If&^2S1`@!ͯݺtI2o*#,=&͟9"+A$S_4u RcV[VpJTM {{[Ed2F2>"nqg,^/v7f/3KKKz[tb)HuȢ LPS؊O)8){Žĕڝ)H@CQ=aSD y_1H AN(?TT}&\PLj{:#>|\DQkV)CO/rÁk;9O9~)QH QsǀE)\@:m9*YOw_=!Ǹe$>*2x|*QDCH?yj*(dd| 7I}[´5ʹQQ R`x堏Qk$jVkݶ) .f8$ +xML:/7 U12BD2AaK\ ,fуճ 4]+ @x e)AޮB}ە7twi\ +1Yd F.;04 , aٶJR-_ӱ yYZ6{4 RC3ew;> u'zr\o@i[CYfWqdD .h&SH2~,:;OЮ2II&Sh^ʽUtФMRæE*-l ւ? n88FxNb@/јe`fF)T4ZFk\dPEK爊T:wPD0W$0©{^L[t@4j'EoΫM1iR@$H9\I>1O^Ɖ(HػЛ~}!RGCckpo]EOϊpxe׻"ILۛOo:},!5rAPϺm&R4]"+~Cy"  &E AY !U-DY ^Ox.hSƸԦ91Q|`(^рhS& \ncUJ%,t1 Y0e 0y)U)itX".hVpQ|Bhq#ɪ&0^Dـ<3+cn?pukb ~Cvԡ]DaTj\x]]&ߊ42;}y`Ƽ/]ǂ\!l.U_֭n#)}19+B|}fk՗8iUɄL#Z 5sb۔Ӵzf[!U%W9c<8r%79еU@樈!FzT|;n#J%s[#-7}3+O7cg- Q}y{KK^|M4/_C76ۑfQ*ק`oE x"hP~0X[Ho$H|~Gdl:0AAOIT:_lhπNkGkѿ:+)@C>rYI  x ux,%9D,P'0QtZP8@us=уA㲛u濖2BGSs]I@׸>h]& `koZ I`S7]z]Rpj`26!`-jŵ؈}SrX:FknJffȻ8?G.ܔ9>otwWvRYw% GLb(ՂŻK? gq?ލ"de! 'gM+dJ>祫]! Tld$-^|;K 036"s>dñFi\FTg_csvJav =11?\=?Ɯ8TB31ob #)_rU,DSKX' i^+yjKG]A1o`%yyeM,ņ5 $X[dAmZsc@@q 'o؂HIxB6~/.=9J_ArQyFwt^L*꩐+9<0ГUɝG7 -թW~wzGyc{&b4|j^iwMz/ y曞kYP]K1oZ 42ṿ賄ݜppchqϳjm[vk"!h_(7էq &w l'J8 \\ J(>no]eĘ~SS0.m9ǡ i3:٩NPm`#BbdCL J#ĀP$b{&*1a07ŕ!' T]~ǜ>/^QWCԯLkѦIn@Y5I!6%Si.lI̱uHd]\Ou݆3MMdv-\7zpaxLuy͐ފ4 Z)!sn1~:o|]el$2Z7 tpuaN|r{ʚ,]β(L 7n-Zɑ>oҾm%ѮPD,*?< ucPa6}n՞n* SCBAb?k&`E5T0fk)HBHu|%#"JV2)"ڊL@Y J%aV"$+ PJ3 $@Y0FP>?9=qG[GUNF~ d% SS,!!XA@5E6T9jpw̻\ G(v&բOD$b֦Ţ@U0'L1fn0MrzPV{5Su%! B+X$2][gֿQCReµZL҈dDa(|Pss,]=ģi<@$a$S{sF] [Z/)-Ⱈ3ɻY|:@ϸE8WG,<aX- χLr^D%5f I#'/-~$-/)v\ ,}Y<92Uz.Es)֒~O(QToLJ%AJRKŎeL5Eŭ\ϣ=huѿ%DV( S]kӀe}fv{:> eu{ME&w;ăqBW^ c!zVk6C1loS"R4XE0&TPe3ADcC`{Â6K'YΥ>q%g+!sOy,Ǖ>>;q!>&]VJ:&aYT╯Av<|/KIJ+ TF %):xJ …%UFQ^)VEl5JL%;s'JR<2UNХez&%8S_X=*Ts`zB /ROqǦݩV4$Ϊҋ;ܦi MǜSRSVKz] ΃H5Q i_ <p3x1\㪫|DNAvT#NfLªE /hr?]};q7_)D%E@y|؝ALeH;vuj.4 ziF=~x<\ca&nb#܇EѢTx,px35{!PEM]}#=^CK2i}vLy:vyC0*m`!EE2y΍ $NUgMIxlYޕx IeD"!κ_qt|qz\aգ&E}tF;y|p۫0Aʫ˛/l#b)Mib|;ك}s_=S)lG[EEg,30;dΙO/8N;eXxd"F< $S v==g4@:B<8ULfyftׯ?&9]]z}\+6zM+SS=j+E6+ajk}:$J2} d!QRS^Jn7 I!hgPHG#+)U4tUn^)֔WUk,ͤssyjt{wA|yj_'L<鴮p9Tn<~`wvLOd%xBo}{iT_;}{Sؾ{ݞ x NSRpiĄdD 8l%uAwYa\Wq Ъ먍*nŨ}p=cJ6A\;hfv?rEy̫%A=Oi|8f1 $ֻsobAaO738ש@U'dwL1c B e)N5PY0d3M;lՋbJ`/K4Mm2ҧA{ 0J| kXv7>.ӯb?:F! /ua?N߅,LDh2s@ sҹvdKmeR@(K*H0LB"P$[2ݷm8^̓bYG3 yɈW<$*=ԦI2V&+fk'y1 Ks*b^iocѮe/7 qLۥnXm(hcZ [/P-<|t'\I{^{ZZa10s^vbc ULlYM&3!Dq[.TM 쉲\lbfQV YQFiZBqh,FHT4+ a@&ZB[(LQfZM%a1 !`#UmVAPQD buhւմeH16.R؋ESiPb"bKe P4" 6~1$hDM m4SH*aEh[RF d*EG" XBq7l2+JYDQ-%E#30pĘ,,D`ޱ&( H(V V9b @11YL`4iKS R̨Q0E ̡*XYZZ:}3k­!4Ȉw]~cσiGipfk39>~ho}}&є-Tϝ6I~0Gw @!x {!@~\P(!zTl`b/@n 'MN z[Yuyp"z`o}^]GBZ$MgNR !ᕸ}#5a\'ТBrDlj"4kig?a7kj"?˭~"ʼ{W?޽o~[MQS]N?_U]ɒA!* M%%2k7K! ;='IcQ{ >wGg]8V#W얙J$aOa_vN<5* jPX@rU-" $tLxzS KEube=] 7 ;4ej<U{i3w=wv{=nts3_*^hs!AǞ?n/0<'xfӖ?jy^ԣIIZ"[ARY@D$6^+NTmԖpO̳B?'bc/5L=X1$! &<73( &ts3Kn!ٱ~aLLkx|b4WcU3T6)n;YWUm.vf 66新itka$WWFU!xl2+͓ l ~zh5O4?&Iy/ 7"zL-EnpZ;{8↜W7Ā=)64J8xx:xqݰu:~׈J?[a,2IgN3Qmr̔(oᷔcu^zKZHU! )sU_!TqY=()EPbĈFDo@!+ pOEp@t{h7ScgvoB)pwv+&)a E S=i*^7Mjz6 !:FsNC\Uyi?f"*cqygcD8zh?C:?7lqzd˚3wp@$X V)SH$LH<|KnY5tM]2<@<%DN)b;gJP .Zcy-& |U3zڟ <ŬJئ0a E6Ȥ{+j&cC]@;dLcj:eB*2N@7Ap6CEssCٗM>⢕Y:28LGM w{ͭh Y());}+:cWX&0-A .MJI1DJ/89,c>ͭ8纜Z1c`삚iXWzFšYFN",a|VF͌+&Y%OA":58wPfI6DZO< @b%3Iqnt~j?uY#yD{^Pֲ}GLd=}3EQW=3o(9##<<)DBRDQe4wy) o"߯i~VS,Fb[ƧըM|@;D o7^0_\odcXWMJiID! BA|zx ce^m_5}W"x\[m.͜e0)6dKJ+=:}d 6e4#2I`%p`O z [7\qqPS|[pbLۻiWR0r @C1`7p`gC  l_fψmS}7M v~}cE9 [lɉT}$6LV.,4iu29ź$B5]8^ۨnU"D$^Xܴ_( Ȗas%I=5ƕ Ʃcob 9߉0' hD@)!%r%d ; (1d2f`vr.tpn˗8yΙÛ$&LgKpTblOFAL=VU'QD!kMB̉Aac o$@0,#\ K& "7PM(hX߅aZD!1f-&#!$Qe/h2I4t\SD*rrr22wjkj Jz@r졬w!UxO!H t_U)` pJ`Z11L ]/21FDҹnZhaAԏǧ֦5Wpn"ɊLY 8ma<h^d ۑH@!ȞΖ>RZ2GZ'iܜ $F8?%lyK qN4jMYEތÛԑϠ0dB$R3}S.zА^ZpP1fd[粭NRg$&He9ls ((0Uc4A(]^s(gb")臉>B@jMA OpL,h<'d" Q(\C/ QZ< Hch*_ !@ ,x* DVH!@àxv%HC!A@)ud(rg֏=.謂, {]tD~E^}ȳM]=P0$&/k٘x xC)K?6zBnܣ?^C8t :$!iı%ҭ!_6g;Jy.^…౳ (焁$ TyYY>Ʊ5?9Q @R h $ n(Q\qv2l!7M{LxU`ibn>Ο3GkF=̈́GW;FH@HtFǁARN͐R b!(g#4$ q!a-{}y*AE*BY5i|j@"n1M% ޙ@l;^R]51/#BmoVueCh]z #tu~^zKOUş~|a#I'hPO+[֖$L86m9 `l)6| }%*-vj%3K5l$5SMEi0M[ q$WOAtWF'tG۷c ǴMa}h͕L^=N= ^=4C!a4g`%],{)exDbc '#p 2uz<1Őu'Bt0JV/s:B (*hkXXut]c5瘚@0W ΥfZs1ȞƞZ& LuQ5EWТ+P[28|:݌>S2Rg]Nim+ 7@X!0P*?wdL7J>,:nIv^ I-F0yҭY7 sиutK#}e] 'Tzk6mfփp`Ӭ1d\0b@T6r_@pOy#"k:0߀isgɖ7x5dU1 #4JNzAa~CᄙȩᨡУ2j'ij`>Lƭՙwj!Jmo.ة9ROԟ_ p*``[Gfg34+n ZSْ,5}Lf>"C{`e")砠DA%(Wb=?TټZ@e %"Ij Y֕0u1αȧQzEf\3 T 0X6Kye2KRiUk!n [d^~$Dg<'wΆ{Yҕr/W:Sx9y jY:RiO/֑y em%jG^n6w7RV&D|-nG*<cRe{.qr(BcAQ`tko w07EO&mLb:ܴ->ke1K+$v<-Dή+? !_r';謡],+Bׯ )<|/gڐ~l\U),A`oԼ}Ia@Q (T |kY[JDϛUɭOAlV޿ե}Cғl  !.dC&+v<@շz}8ރ x5mEt-- ܵ}Tr]ncg` }eϜ~<ܟ`I?\7lCz4_]?{ߍ*p3uޔWRVFȇHn?7ZgC uԱSbZݨ0h;z[vZ[~1M*A>3cvVGc "B;$@8 DD+<9~U}b8?|25xw;|כvaZXG C8=GL,: ͡jE\acD2_I#1q fJjETE ATYc}CW*O%?t*E.EPvzrys^f揫}u]krr[UA6/O*pD~S('߂ TQ?~( @U()lL* BUܯd#JU># O?r@,_\=Vuk3 /s/+X]qN?9t&SVc9y\/F女hyZƴ2R!QX 9[k5~?oqWN:>o6D}xD@f*"~x"8툨'7OF=' *AW. lxNƀޛCf='}䛮PƱLk1 70\oM XD0<~s?L6_.dd[ /Њ#h Qu0NEYBl>@&B .i nax_zf:6GbK }+ 0Zy7!$Le׺G9F3rf K1@ժSjbd [PI7k&39nBq C' g1n tdt\d}<$uOg ߭l<s4N"F]PV”"jA)Oy "7)C Y=ÁX%79cGS2U6#`PkP_<@A"t @D?sesADH\) 2M?  MYjモ2?@[fP<"!0ȈN)U@.ZUhPJ"A/@`(Xΰ2>1D]r!Vl# WT;;Yh}Mt"T}__mh r BxdÂVYhi68Bg.oq4 y2$XFJcxDXvL'(|Ot {P'EMLɁ-L*t_xݍBcqe$#.( ] ~PxT YڲN\D/A4 |lP:))p`H9:M"! ?%y*dMyV$n*/I (D=G6B %@~ С؃ ^ە% (rIuzJE[͛K 4-ow< N$LyJ=`&Q5?Xݜ'aD)b6Vo-9RRө(.[{B@rđOt}] @y'?ŧ(@ H"C48MѶ\D֚u]#kګd'SkZQn4: anƈ 6pA.aeG$(ܳ:qCiJLSjK J6x8xK"a)9i Î|Q$HLLvL)ԯ MsKcRf 7`\:Co4ogʾt*hS W GK0%T!FA@CO7iHv^ZMLUM-Mk*=RĹIHC#I h4w^uU諤wƏ =?=pn,˟6"~{Qw^ xK ^ G#{ݠfTcAǼR/ӽ6fXTwD^Jh(!@*&A? [a2wۜT w]u'{W!+1kMS0N-F*hю?Z*)"v@(h !bA@H P$^(%'%DI -Eù~vwu<'S:(r,k$o:A<{bD.@(A J D<mS7_<:ubLp,7x(G=d-yyf) iκSB]ryD/;82f?rPl*",z(D&qdm0~R/-Z}^Z2a/8ʼ=>Ki"m4)[,E@D CϐQ?j ɥ@$W?1GKɿ_ DnoB uS@z@:*4Q^p" |^@pU1^y CfDhAˤ|ɜՀQ%CI+$D, )"!I l4ہG =I!%to5CY?gí}ſ^?Ո!c_ ~3$|?OL|nUƩJ3 h y'ځ"V3搹/#>$ U};ghٵ=zd-I 0+ǞBظ;Sv,0op"$IR ~}.K>ois.ֵ}Ԯw'c)XWwW  `֟ѿ|7imߚQW>f]MdT kZV*I["VSTSS'SZTmKa"tg`J]֕MI/Fk[/Gwk1wt;7_O/]x 9vxcJ,^1FZe_i^UY1b=U PϷ'ĺ[5v+E_γ?Iڃa4p~աt >]$7t?},N9g+/o!S& m&EL[|Ԯ`B"UpX/i*S׹$C}:\-͓m?r} ohq 5džk2 ~xmkCF2@kK9>1\_~X\e8+ .$046ٮ -ATp]p[NɫY^[KZ@:9L?Q&zJ 0g\a j:[Gm4&9EEex HLD/*_&u^0(pená(|ŴZWbWzw5 }HwsП<)SA|X8,Rqx4~H2@9>^i!|o^T'Y`AS_SˑUP>$Sw) 6fD=]Tޙ $XA;#ggZGL<>^pX^mAu[| P*h_dOlH"t+V8b3L\ƹ, ĸcIÉya"rW|3GUgmxN>3ک3O;4"݆Os) }ZΫK-n\sT-Ȯɲr0zjFs&R맜ugiUl}%SE[2șK?+wSr u?v[oOʟKܣC Ξج?5>O7dxN~>1Xߟ.=O3JM3KYGE5ˤs-3-dk/ Rtu#L{JV&/.xp'g}%mlݭ>kĕamjM}vd\#畤~Wtt$f!Ȝ4->(3j%%盵3#=,&>`:*2Ka Ӛ:J3':O$ gfka̹Ko:M#?~?zwK/o_q?˵`{ 0?]-?~S~KOCmve?O%lT ;Y/ zbMގcs4Lciۗ/hkFznPU@)n=U="OS7*QI#M*@XItc&$z%W-|MJcAk.$P9^t6'9V^ `JoK)rILBE1Ą_c$Q"Hy]bJIDDP?mt9n9<B^c((0ؒT*W=DUm%<:[ϥ-P0‹R9|2Ƙ-ug,us&Y;Os+f\2v߻?,ࠡiy)Qv<& +N{\'woqRm`~htɈ+wת {0.E+N˅k+j(Ȗ ґ)VUJxI @34T]Ws42UZc5c!qcՂB6@ry(Pq2I[j: *JO[?qV Wм~5ݶ%߶o7>%hOʆr'(MR .p:; (#`{h`gLd PZcfCB4?pk-La .ї> H!PjI}2 @>˔T k "πz~ >$=Cg?͠p1X|ic9"72@Co aCaqxd/Wl%a?7F,~[FͿKůi{2P; d-.EKfcTd_xΒ0Td5q=0U ,)Ρ F<]/~Q 3͟7[ ϼ0*M@88+0Y0[ަQoO_ rǾ uCv]ռlZI⇱vk S'uyr iiK{Juˁ˵2hza-v/TNg7y˘,̄ @ޠmĦ D"1[ ܦ\,5*(x_4,m+wBEA |ӎ |QMt$ʿ7oFLx\Z\ 1S>ێJ xGғ_aty?R| .ƖT5j5fg^mNqQMuWO+'xh)mzZJ걉n|s_BVI|t?ZL*"$ƢWG4ZԦ&Թ#Zo-/ '! d)\ qkΨ1BeĹ"j\{׭RKg-Rl0g fy2;y7(qS5XVBrM%w9&`)򫚳tqғqPBT>ыq,K2. K!@Lu0Gv}7ݖn6;A0$D>U'NXYeD`i*;O#6 = #NJ yhO1'*F@[-#wA߆db1ӳ {r[T?]h"#dCV`ta e2:LFt?jbUE0񟺨 VC`I#J&KV?3nǏ&x3K;{;5WpAĘYͧ7"j/ gL(IW;7׵^^_?;cN 14K}[_{ ˛%_~bȇVKLBgzNϾ)VGFߵ{K|p(T~YfS+uwda?!9uU^ٙ0gbo3eT7MZHUC4ao>w0)$˛f<u6f_Yꡄh{.y`t:Fd's9$蚥LjU kXNY$[;qU\',y,ӣZ2 $x7nrݨ{ly(r-аqw2HfHx-)Jsr 9V܉Zä d,0ɵ|=k7PePcoKIZZDwg2L{plɽ"ǵD/pn^J`C"u?5kwYၦe/;N^a8yP@bSQ$!=lGB`>GFGiE_uD1a~6KPU,Yoh)CCL?V nܿ>/ݑ?T8B`uD7<%G <2M\lM-! x8>O>Ґ1n¹]6^ '}ZC-7ob%po@@͈ D!8h5?{!N  '"r9\<JqX _y$>4>A*cK_Fj?q}hmYC8 'yN"t~jH>"QY\ES\em|XQȘ͎|nhΡ,| {uӂ)" |kV8+ԸM1KSfQ?^<.DPL&dCr;cįI}?. -h<܂=ӵ 0$£GajK&I?;U $_Uq>HF_bXڷV84Waz 4oOg?V"??٭̹j+/]ʏF+ %2ǜyJ鿚{[DMtz]7~LJg4L;EȀGk|#1%Y'&r7nB^} e&;CzNg)Ae 2$.Aqzu ͆Pcp$wk ?$Ɯ62sOrk*pJb`!^mN%N}2P/VwʟW'S(cEvpMYb hy71!C˜^J~Ύ[mv{ C"(zx8U)zkkE q<>wCɆhH|y@6l~w@)b x<5htJM2 9kWewFwg&ȇ1e7ٿ^#s ⡥V!s~\^ZW.\<lџOwOp~YaY~'tTS?=JUdoV3WAM{V73t9F<v@ xk"8 !+܌@8 qCB>8]t.,wժ<1Baa\j>r]U^ 7r 5㥍]]5Ķs fjuN=ޚL~5yk\il#1&cP"P̩e1U5 x3]7l%^4^ZP*@1|tDMEO7#%QA$+pSreΟtWF eLed?YBf{FgW[Qq '~'G \JLŻ7U,a=+$|eC`"BpIZ&Mw]}BdZk ucdY_ =:^%B]Ɏ%<4:OhnE#8F 3ܝwL_O2)'d7P#po읂ڦ?qԫ*j򵔴;5;q}kZ(sxӉD sz- 㶯:bWgsHV֦^5.H;d5CSd&m;A5zs^HG/RH&2Szyv埊_=Ḿ9*=A"Ss'<&~߶n ӅSp_t h*} d9HЂ'+gKūχWHtZ ؼ+i+)PGhjC͢ddU%PwV QuákG/BZSvwREɎ*ۋTn#efWm3YwT9Zv)}(ƖĿC)TsnV7fTEJD`^#ʷ"y}T>)3h//Yu\bN|@9]㒿l** nu+xW!kǓ>T׀vwܩtGQ١)Xd$,_g4<6fw..,~>#ZHܭ ~=rt;Z$:8,foޣX-8yx.8oTp{,;6+Wv3[U<~Y^fvqlI;ʽbU]\xzG?o%a5)IpCC4&Ę9 J'O᯾qR2́a$޼+a~kuIt.BII!ceA-k=m/˅G\zW\-AҒ;ed[wۢNJy  -A @/׌!v`!OĐEhs5E+O{&_ /:|5Qd6-d&GEF:0V,X"Ơ&|0{w(&^ϳ<8:{ 0Z۫r8H0`6c`IOA+FH *;=+cUhxݨȚ~)"WHMǛJstJR2oT s깚on.b<ɆРY'i* v3{g~5QIԔi2uM&mUcMtIp$d' T -gd$fq<#p* >5]WcB1LM?7oe\:Ә?ܷFl  E(|XJ Ѿyw;YX26kC˧} (GZ=hSt"pɜhڼF~WX0ln8iW`LPz| =Qn!@dcמFexIA=2-%&ݍ+fkVao uyafbٙ>>=NbTKRIINMOXCM;a?!tp t(.pI+cfs?&ׅUAGBqOALx|6LS2\}ޥYPm 6.׮ yM<0*1ޔέ뱠7y((a^ϲN(_=iJ(6ƈ蠊iK cNdӽhXɩp6b5f~s s~awchDOA#>,`, [4^m_p{R Z),-wIaX(”K e$h=[y8еdA+F&]^(t. WWK* X^% "l1Xaz0R{GR'^Tcч5ܛ//W)Kѥ]u;=¦)Csa^Z" 'μE= ʊE bG5ƱDK-uڄդ(Og`EՀo'㊨x|zN|(+}{y7_UaU uY 0aM!0c1"f&Q$ sZ!hL?w!uD&Yp˅ 5n:7=0*Q؏C1jt a}P7/ c%Å;{^) fEa7Bt7ݧs]mN&S:.^(nC_յ=<67)d8H` 9ya_j6pȱ,tQ׼v߄ׄe؞| tpc쿤=7ǒ0xUm׏d&ڥSYHvG:JtNT=Qo< w)Xu`G41 񈭠mH'mQT ~R YO7C<}(D5߬&C|'],@|g-9| b!| 6P D@ä/Or=OGk/?KD?6G?#AY1]F֋SPvl*(~GBW Kv#?֟_h}=uǥ^y#GΓ(ye[+Rٔ} y]}'P`tI"H;H17yG=Q>%nNHNЕ%_}=Kh0`i=]w|L`B_=_mE߲/ f5)L@9HŒ ԏn޵)G^v+4 OkH$2iCnvtሇp%OnV& J$WCR rK&v ZvITEZdկ x#?BR}ﶡO)g;Lqb~LeA%Gh׻w>*]K m, r~g|Qur1wEs}3_=Z>Ư4֩:ξ=?}OH'g ʨ~orY6H@aO)5JפS'&fP%&t,%­'q8+. ::}ܦ d"YB}O#t9 BnI) K/(Ka?ټȬ&.B u)lG 5ꠒ1v^dDBvSRG5,iH׋g6bvv>X$DC;-[],vNgpzTWBquӓS3A G Oj]c6^NPRsWwhTN]; zvӁy>͍yoF>Ctm&Ov*;9{28ئ]mA H",$C ~C?3|E<TmcUH?%&\ R/j"Q򌹽$v:Xld>SM$U>b<̉7Ӝ ~ SO'3s(*9Sg4 |\۰dՆlDs/!?R~o}}YD>LPN")HL@=t6 c_=)+Ai?a͛.!F[PdCv#TgH@=^{32QիIbzώ4a'\'PPj?]%_iEEIPRi Y˕*Q?~)?ڜ*$+Ƃ^}?_uy;05. ~h3iSB>id!BJxd I@lȧ؈O68zEFEP $ O+\& X@舾A= X)" *A^5AyP}!{}RmD#xkIIꆴ]e֡0? fe-Py?6T1̴r>7 d2o]~#4Rjϙqv Rl| cHAbނ^r7PK+<.J>uسAMH7YbP&2PdUBE߃Z|`bJpȣ=Dlj6U.~>kj۶  ( Tr@ OӧA :&חMj0UQZ&J4k~!,*WmQLF_Ɉd@\ ac[(PrWO[6g"|TF4a&l,vKWSR(2K^6 һ!W}lF$OX9Jz ={ ҡ\ AL`Gg-kelGXNf\`xEC>tU'!燠Bc 0hXT칓 Qf-krm-J5b ?vZ ƍb xCt!4{eȶ]Ú^cy<>1fhLD:l~_Hz5a:)>kU7BGe|kݴpxΟ.ʟHDGۤ+m$$^PECup56VŨ0Z> Ġc$moK?Ji͉BߜzϗobwęKz/ A=<g"K(AC^ᾳק˯W3 C]^wT$܆nR(i5c˞:#<% ȵl ɢR5!R۷N̋ @`s2)}eJ8͹NAb@_SxJ(NlHoL1R.\z;vԞg6p27\\3 ((DD{S{xCR gj{]xެZIBęKBLȪ' %ka6oˎk+q| YOQc~ZF:ntFtXh{Qw<wUS].>ARj'Ks3b`@|aq̞D7CUsja!#ݱ XLJ#H{-UFTpsUSMlζoGsL'lf W g^mC xԯVІ=kT$ \Bո{5 0k<{:,rk~<ÓYZsJtv^Fɓhsc]OPpt ɠ& dIx;UT$C`ETEQ}u_Hj!x&"[GƂD&`$ axTLշc1&~n,1`},|#c6BjWPI/GA k_RhdZ]m yWmosshq tfc&z`+AH3(,Z{OOk{"$+`{ ߤ['h'qk "i0fK>*2.C∂V- z NuBxьxz)`ǣf4?@&:Ͷ]J{?mu"Q_}"mM^Jҡo}&AmM< Gnִp|v+YX`f~">á$Eq,!{Im ]:lt];bwvbzKMeKu7 ߛ[eV;vL.L0Fz + wVZ㹄=a_nk{/WGWv> K*c\hL<FD6ΚZ>j`t6HIGy$?7M$CZnjLpf!C~j[n6m.S_'Q޿c`Oam]Z0ִ,@" lcv`"1X}կps{^ ٕ$# I#IUDAUUb>_+p۽VxdapQia2h,ǚ9@cIk })[lUڬi@Yo]_Ebըb-p6fݓ**Ζ!p9lXBw!ӹςhc[rdt-3ly OWϳ3TT J? hd'zQew?QбE_((?uYx =?'Nuִ͈ũΰ:uJ<ʺ.UjM=ʙ&VxLٗ\:g:L!XVD{12_ TmxG2p8y<1Ib*O4rk;j~eY8op޻lƞ=)VJU.v%2$uRGغƄ|MD+:]uJqY!s#hBVwشa+|OɧaQL /d;{G}HV6t/I9 (yvZic/*5>\ jU0pn?"K_Lfjwbvc, a5}!tLbt[t`-i;:vhQH9}XQU^,#aƤBLs F\[20畀,]{Q> y0⿊zj9WdQ}K)0%=z7ў:ksPM"E?GPƆ?ş~ÛMZᶁ  O ?Ȁ7qh tTMo ~ס[ swyX=9b[{%Wh?AlVĥd3tHV9̐h1h?]epw Utc$@-bՃr=yefDQBoJ'S=l]َm4RZeesmf|A2Gc?2ܵlT> :o-;z t+B֯ |y_I~OJ>9|Y]~9;&m~߯8#Jr%*c4.lBdOٌkQׁ'}6R#IcD%/W^o8 Io0/*4S0nɀ}&ҧdȣQí?XKo6#\Y䡼V~/7WIE"ӏ/Tt~"5鯄 J^8Q>*sq GE/Vj3M\ؗӒ/lDȁ}U4KdE:j|Hrf.c!j#CxYKIl9c~0i_g0*K<1UNnyWh\ > +KR}~`sY1! )S e51!+D|VkmTAns Mْ" ),ӎR@q.=2ZvR?76^At{2aS~r#"veSmo!~7YؾQhг?|aX"~T+<ỌX-Gm5,="-]-:}"US,@W0q:¼ءM#YLx;p-;SfT@tɪEa8avW=S.B&wG_V")uq{/i aZK6O-iWbPqj5)tw.1tHz&כ{Bwx]@T85W}MaáDFś[6q'k0.gH^+Yuq4C-Qzu,hUA/N_P}j+mz^./iȹ0D>v,wJ,nd= ([_ esz~޻1R:'fvt͊eȋ'Μ9L^ᠮѦeBE$@ °[dc%DWjy;q+[c`3][K; FCTP[Ua v`zxesoyo뾭n]}SJ綝 q.*'Id+*d_ȫVywKū]'.E35e_ ZG7굑%%G|la);kԭ,;aU<$(8#ׯ@jm0xp/Z/aDTC˜x l HE$I3"4AbX6_'.t)Zi$pdQR'LfP5%12,j0P4DXfH~& ߫V!b@v^WHY!8}1xTwI/x~J^TxweǍ+=^}[F(b($b_҂ S]j"\˫-5uNؘ9dLjp1'H{!NT1PKw*1.49C~6NB*S݊O%LZv^4Ju69&♎`;TL2._^cηJY##1q hf}Z)TJ41]I}N{RODS9 0$wou<|Or]4!'*X;)Fg:꧊;&$bUE?$OAdUΗ)ݫAp:ӒtAmQHn+Ui:ŀ>CDdD±Iم}-TJR- ^ݰ#_T!H$Y3%#xL2zݼ\΄X}y?#" ޼i'; pAԿ^ QĻq]|/JpPڈnIQOv$8b5!o0jb-W޾EkZIN&^Si$IY.s9ҕ dtI 7ձF*;3.W1O0ȔJJyR$06PN "V\a z)^N&5bZbK3cq3O2-Gx-)M$X uYI)?-OuֶtRYXr44-7SϴCpU$}9+J)gO"jcZJunKsy=%!TWDҒn0[{MA=3KK= qBҰV75G[])FN.vN&>zZQo;w7ר՛ZKGA|R/,Dw$XWջ:&Lh($8ST?PX/,Ĕs-y؁8f5l`!IP5^>G] %,lȼXٕS) O-IM^M._yzd Vw{{ vڍ箐K (ӣ8$q8{l`+~U=C2iH*?`"k *钧,)Rm`]e2Qd)7r\(`IeYT+J9(Q9JTz(t[/,I1l#^s‰ZS$nAIsgZYQ[$hf{;H@46RO&`T]5%&g^_,P&ln"\sAե@U]{RF c0kٯoy& c4_])_wKR&P{ OᄰITT멞xS1ZRpߙЇknM%޺KXϋa5%&UD)/D!UtV r֧X) :-i'ZgcKe*N4z2*n׋QraȞLӐLb2K0[;f4)S[MɞdVѽr@A33;DQ׎&/\y X醇Q.Lfa 95*BYi?G¨mI|tf:Vc[esC c]~4\Z39z^%ozP$~nѪyTe-aOS51LɼnR_[RE^I*0:)9C۫&~*&mȇUyujrI Z,oH"%Փ[5İ2H3"F,'tBbtj["EqJu[;W*c.mL_Zo2FQLgq.J>2)Ss݃s!Qmٛ9PCW):d$rgZng:剮^b @:1\\{AP1tyL޺eY ESgڒfq cb}Sf-{xd :Hލ՜*Ӱ,Ε7*x5 1y=#GUc7WO'/eAk:*ԑ<ԣ^pXYK 4 bƲi׷m>$&؞z+MVxU8N# ^u--|ET-R+<دdb~Bj)_]oeGzEzf#T5 :S᯽l &lWV& tay/Q:zow)i 0=p aKҤA| w}*_!(\մsaNB0czy}n[͖zBiOZ Zހk#V+m\j7J8) c`bRj)a~9R`ڒJ8 M>ڬҵ-~v6lo D_$S9D"<ڎw=Is\%W9)DhC"]S˦NYczmq.jKY+;U^re~yʦŭ, &5NygZ'kTb0h:)Z4 `g#/a9'X+РU ^f)5w\C{]B4cBw&!7OqYJkJ4q[zİ4TTdI]EI䫎LO͊Yf~e݄y0 X%G.XEI4{-iE?K]ZfBaoiqmwYwrmrĚ:ҝ|++qr\WԴv RT|O]]M\Jv 6qK]It:l,HIDFUOum[8OSҕj[NPispCĊ}V܊yh&!"3]40cGvd˟ TvRWMr' ^xȕ5)JPuMxpNQfDPT$Xk9̕{u1pe¾ 5c1ˡQr9s LO!ilk;m%@rU|RuLt뛰GHcJ\q&&ڝ`J6[BdwŦoFa#JMG$>9YoABX3e]czc_䔷aS$I_mSgsͱ7W֮,r YCau>oWˆvzj[^i&rl`%a=Fr=tIj`}v㵪[F7vKɫ[|b ڦyݟ$&Nٜm4A@빱_o Z"`i]k%zAZ{1z[+ZY-i̕ _$`y8]a`MU>4[%5קFlyrWT/I jZKgj~bx0%6c1e2d9vfjRSr|HFi(TBA(sHrukHbi؀Z?ul}׆2j]Q39NkwWvo.M5}8 wl.dږ}ixSf8a.rgR ;^}"\&.Fx6_ssZ(; 14khLEfJ/  q*t"g=u1ÅWJc:xN-o43Y/mYs2jƒY{v'JX5 ǸH_Y_<[!x.c;LuԱ=4ܭgI3 ,ʲ㺷D;iRW/1Pac5L, T~nGb#?ԕD)I(7ĠsUt9&EY޽RVyrj* ^i0Q&(#4R)o}_$',03' `%nIEO|o| dhtn#ntݹZo9VT2$K ĴS ւis.Bma& l<2NC~279[*k#e vZiPn 3o4OBpt%3?RDTkĠœŽ'iVXbˀ:)z\b"3[@aWvnvf_B p)bM^.A.N^0^m"S/hkmz~x$XJ@ƦM vy[z,o-UjKi]8#&+ ;VOBjHY)!ϟ5u/'HC<$ˡ%"# mÃsk|:[8e>Ϳ.1ȋl]oSgkeb+LDè;4Ex[MͮEgű):GjWzi[Zqunɵ Y+kYE;u+xvut)iHf멇Ա kot!ӤU(Y/3o_$hu^šDq`-_s}y<BbP8N'Hǹ{` g]A!p$~2g jz~U@l!JDjynkyUV-d&ZbL(yX_G|)s_U_r#Α r{PψDQGEWY5ۘYk7iڈ^;YSMި+Cqf s!5P™-hwJiʈK/`7f3HK@$hϣrj|oq D ЅzwzN?ƅ- T LE_5=g;x?%v3Vc~+u½ZdRXH?vftD:_ějiARӞqs.V2!he fB".P >vtNzR>$Nd?ߡ0"H!3^ss.]k{n; :TQ=\|_3:%I9S DSG?9WDn\A]wljn!TǗC3X~ i|ʒ3"/P$pހS졎2;Lk+ ^Dm?O@1ϨH2 yRE 񚛃P屍eHXg?' γ:yfZmwz;(OW6\oɇc&0>)1rwYя}P0\eKqGhdI#ӹlWJ>sAq <8jclSe"tH`wV@-s 365I'1WpI_(Vnsn#G2d?6;#e +NB\FrX(j`Cgal ΨN%a8P߳ r`p`.[*yaqһR-:[hOJiK:SV!n5*j=bhULY qlIU$41'?rrDH4Bc4,($#D4yIa?GF)$|/ז5ꏑ0Onc}ዓ$PL}}||{!.~e}O?OŬ&h} yaoaU1vBy'@쬝 ?-Mg p JViC m ~ܨHy}o'nsj@zb(DES])1]b@ɹbآ.n"7.i\CxgKV ⚬K]βl=Xrg>/^èe^gZvA@gMOJ5/D@\Wm闏j9HjA\xSKqfb_ h@VCg? u(;AAw!%f7ڜO&2DHK\Tʖ7eEZR H&dkZD&tPx!NMԺP{MF~/[|ҫ?GiXz}9}OBqEs#NtBFf+hPt8ʅ5f0x&I|QS *)nXOd5¸ nژ{9~qM%ˆ~;ԟʺ(!óq^7/Px5E ~@]VLGfMe1&R* g XFM.jjMЦ(LX~ Y}ܺ*`ŒqTƮ³mIYHaOt.RthHlů-Ⱥ~^%Uf7`KƢ:ov~825\)QFı ۃuB/DPOieeeBB2 28{Nڱ|& ٨SIՐ!`NoGK_nx ewgF)Amq&(. W+/$Rˠ5fւ4*@kY%˿ 'jҤo":iLmz1E!PsNa(-knQYTELLJˌŰAjSz58cCϓ mxg{+L,m{qzΨ]4Dɤv{ {]nvޓyO(4+<%&t͙ZB m=g䌑?E9=x{^2Qw머$D2l *p5J8\ni?q5 Y8bC>[ClmE÷͝)Pqaϛm ~)Ԉ2`֞W=QS\$$B%7Aનtkt.~h%=)ASU-##5٥GL䷋ă$0@kw5Ht0Ծm]X_׶uٟmC`ld"XA23 ⒢_?OԜ~ټOc&堖妈1K:ԩ{q0^6{ds`9TPAxhԬ V"-o$_T>$YS!6*!-1,%RuVt}bp=GR5 65'%IJfmR.ww|UEF1PdF,4ʨ *` XR1 Xb@QV EP`DH);Zf`,!"tEJRFGP(gx3L I_(ח%fͫx$F`o5H(L%0:HK ]TkW(<"gp0ܓ\)Di"[7KUi0Dߢjcګ/>6%5rwrviz@å3bаn估ܡHÅ*GRtiJG٢Hvue>uKRA$'So?m=>Jf g}VjB Z7d0YplPׅ"qfe۹ZJ"װ堃dHtEoݺ:AQu/(lia c,cDOC;]_}^W#مw6;Uoťy FyiwUwZgsWQY8qhT7}z!$7 Uy3q޳QX‚N!xayW íJdK5qآ(iƉ^eXhp%5IWӝ N5I.H!L kuv NK#6m pZpPNTHRIl.bg 2[1lugI2]N ˠ^SmT.bCW?ɫ@RvMl<>%Og#fBW8> qFV5x w1 -҈%2zNv{ZXct|\=ZL~p ~y_a޾ד(?[<834zlYgq#^o/b:.TuXk txV=, &<W}{BErFE9\6 @/_O$N?}?U;[&M+й8܏rlaYIŭ#+[MOQ/ Snj`; Ȱe"E{@# ZoŜl3ߤL921 ~%Ԇ( :V"_]p/]F98<ȃFW"2d\Suє!N1Q@^\ J0ZmRJu-ZWJΑ` шy(]i~GEPGtUc)l!1<*uuPw/M :z&{j z'8*jF ku"V< 1a)E1")'2dQGm܋Ɯ0p^JŪ+ Ȉc' `@?>#x ζ{pmo 'L\%$_r۪\2qtm;f" ]pSjTzA#LF,oet1W`q^ιbd ó}+&,XueG1u&0UPH-{kʁ HV*XAXDnbߥ_Ea*Iե,UPɉ",ETQT`J ,|Y14o?-rnaҜv_;.&# ˋ׫^{4! J~7koN^ST}ϵ5 `>CL"J!ʚlۖV2nO˳ؖ :h^Sjz,FTͧU1M7umR1l'cf#]> Mi'%JT1FD pCiCnΤa+4I֩D85qOmx!"_*D+9RO@1)MF0 Y`U1LqF6_)[߻w\J"]cK ~fEFruhe80\R\X߅B<09%@X췝5(H"% D }(qpwUnehpSR4D`]݀i_* "*;v$E 4Lӧ\L(;-3,*uחkC쓅V),N s/!0]v0/n=Mp#׆ %QP/eyAn OB 2w{DpV.|7MѾ bjB iy&w=ݵlI2q p}:lMN,HՑf{Nv&!l@1ݺ@.dm 8o p <^ 8c^:T\cl)i+iܮ̲ ?Ft8h^Ճ ?a^+ӽ +ԣ.DqDpM1(7غ76ωpvNv^/afbcD53;?}A!(y:J˽P?E@Sb]eQHx Гvٚ?pFA9{ Եu\6r dvyllx_L7'@A[$_L(fu1 3d hyh_Zoui)BumΜE;N-+;=ewEmvKYѕ@pO re]: ѻZDytrb絶1^#F.vv| /k-.߯ǒ>\bF0cC#+#%;YXf''E,1eawu$5 lv>F}e"/[?s. JU >n__;lF䨨HKQ` JE@ B !b$}8#4jEGLc 9&Dc6Zuk/h< *>$_+vϽAY@M\eO9,pB"C新$r1Z\n_pR+M! W(Fq)#|"V$^LH9;{M-+!l∡"l= :{aQv,qc|}x!@eGD|TnM8f=0^o9:NDpa G -2y~^r)rPv_Q(s/EyD&͋6).T*h!c\*ְ4%S¥S #FCc__®[?wggsT" S[Zk?.0& 1$^Z " 1=w)܌΁*0 K~:4X?)Ud*:;:P'R9ѻP)j\,5c#IH :%P)Fe` ӯȩ̈S*3)x|5oTS}?aV[ >n;f ͅ]S6}woĤYk6}Y2tO>bߖ9B-}I8"zN9cL*j }41O_ntԭ\hP\C=*swtnvnNRw7U985,ig.~\,M~,g> _26aZ:~"hL7&r"^D>ۚ9"ϛpOgOZF"Y|^¼ 'WB-Wh<oWjɴt!N Rm#f7f3 4od \k% ,D~Qֽu;U)Au\_? rYԵr F ;'}GIß/RW%Z$*eJ{ xM3 !W^tӱ|qbd [)^zg|= DuH=(,` F< ņ2j:"r}Qk9_djWݻouRkJ>ś6%':;xϦE+Tu GP?p46 FWI$bu:Rԗ2/[wg,eK0!rNRޗ ڱ%m`\y?tz3[(ۅr'Nvm;$3$*!n,k)WyWSeeW|imv-[UYĄkjb :ӰTD 9rƽƝ$ڰ 6uXQ,v5܈QmSV_@l=}pV\F#W^☁iVHJQj!ΞBgr`E_.++).ȌS \XjY3z2pmJɌI1{+{DɼIJe3G|/#ӻX0Jvoׅ,:*hK0, 2 ?no@xc%Oqj^!g)\JbZYHtV|tlϭNhXqH#!~R$TK3|5[\bL9ȿhuF+; lӋpkt~8S%xZ=WUfJ;L^C ">^kMM̀L%?u퇻Wbu'y֒=v9Ƨ# 5b( &qu*MZ^")~-da&tJ|?ɻnM)m;{X(,5Irwrq*uim3l D ɩqF-gaWBIsec9^֕( l ȽK*rd`jcmG5b+h4pl+ Qfxh=LZVݓ[SzR fy6~ڮ01jc2+z`h|5X9,%pM1aV}eS^gZ6Rp4B}8ѩ<Dq N44Q8IX^‰"m¹e,g[G pcqi+H39 jILqb P -Zjj!A^IzpʀQ[bi 9ܗcg*|t9‘wڊ &…-+>=%i6坲 噾ay,Z唄yh/$O(C7 ]JK{RVDd!灠$'(jފa)w-īƤjC8z/4ă=e:!۝NMFoYd#H}QmV=g`@zɘݷ-8S{BYẔyH jR -y34IX35n ert];"4zk*]{{ꙊUaKDJ̨I-#>L20SpQhLO5>(dY|-q5ѡ)NƮUo՛0Wv8PCq ,mK)O9kdQN4vdhzm L\ЙbyF#PͭC9Vuu-^,(U? %8jX~9"@)ס`Bv1 $q5eKO|]j Ԙ\Z,|R^/"WˉG$eQJ4TBgIҭx4Dž}:8̠(QCrv$32 BAFRd֏I$ھYD!]\oc@rZ#[Ԏ.\ٰyGv %5b+. $v(gXf> #I48YV˅ےI7=:3 h>f07LXJ2[S6k&"2=H'`j  XF |eQͅhߏT^^Qoo22c73ϰݹα`)*~j1 98M- :$ h-ldp`qRV lWR$pّ񅝭innyݬ馱h-DnQQ@"-tV 1Ϋ eTՍh/x&m {]hFK0'9:ȜJ@h9.GsjĊpӶ5e;Wn@zkm>=8k:֮1 6N,0؄c\Y/ݞ_^??/~c>uI]LzZJ9>.F_tˆt~1eU< 9+VsRxP-+L:4Wy=۪EtYvuv{Ge6[5N&PA`P*VWDY6SH#*V\Ӎ6Hɩ(#L p`v z&9bКĜK; {huMAwMt x%=Wd1 ِB=ox}Qt/~WG~@Qj vomZ%n? oパHewEP2l?'e34#숎6/<r4IW]`P*",DEDDb"E? T踃ضe}7mprzS鮆/rIS$};۾IdR#?{&tۮ\LiWcǍ}::s7n1tCOYua2!ahͽ~r$O} :.5FVdX"d9(i)i5H\SiG5wd*)d@ sZ?:y:xߖiy(@Y R@ZK@ӜRp*\E< f]Zme%Y.>⿺L d\4sÈڎ']jAyM~. U6Zk"f&ᅪ}8=xg/;ĿmbdaAxl8x˽f:53$\D 6KMfaxȜ5 .g% Tt3 i#f:#1 !͐4c$6J#,p!yAUT̲*&dfffkd{ErqW+j6z?wUmmwZ3o| KcMH7ut~Y#?hjUk /ۮe2$cQ v%g;m _%gИOxtVAѐY~#0  猃{qD( gXN_::-m:O%|{_95`2X'+^luvT5V:_OЂ|BFZ?íLÐ{#e"{/ dG!! 7KK7B9B;\/g .: 7 0dGޯS32T~* e荸NHx) +'6y@%z^}zgt `dtB@CB0U8 uW 9O6"QL&~>%r M-ڃV{PB>OYYJ7,q9;+6ܽv2,5zߌ nqVr7]W.wpLOvBeN> MiUՕ]Mmh薴y⢢~ϡ(e2̡{Ow^YO/ʙ)r;HoDu!ٴNfh^H`|쩊Y '[vU&_FFؑRZ2m&率M$lb^7~$,v`a(ko y,G$PBgȜ-*s9k_gU56κ{d \7pmcp?.D'$0 * \0z]5t-ԪLuY2Ǟw=,Ni'.Dn AA )+Vj){2܌o96 :8tjZ)ٛ*mx]Fwyr`8RȺco,ڭ99!eTv=kZ؈Hra{zן"P)wCzNO4NV31^TjǙtlwO 0Y 2PɣNVbTTDu{:ID4+[s&WKZF W!kcRr_rBNnYͩllԣ%u(Xɒ٩6# ҹFY6L(qKs}]rkN:ihgD??swW-S I_ʚ)B~j9oLK #8Jtkۛ8mȮߋ.f ̻['} e]>puݞ+1QndWsp{:AbY!_ݳQZ62AV:`$AfĹc;)כ03~hXœSkɕe{k*oK%ZUYmSH\Tir{* d;Q-8l SMȠLӌKYόF~ ^d hU!(/Df7#] Yy9jHLFc.jy1A4뎵<23/)CŀԵL>3=|hQ ^eeA٤0aI"$GyΪz`΀X"qa"BD}PkN.`~LzHBŕ%jjei  GI’BA!! @$?Owx;LC܉ɚ0 TJq2.V (SN:w+vމW Dov4OZ4EPUxkk;JuG:8~Ic=>fL+Yʠh8T0qyt+HvIN03^aκ3i|5̩iDj֗z)xf|Cx}a$U&QП&7']}gP̨.-Oɶi@r M3vCC30>@z!,P senЃ')P9"./ՙCay5<z3%UIUr(ѬLOē6>K3xSJn|Iu-OgpFLQmK_~ӹu}]59ҿK۪7/Ub||Ij~R_l+on:.=X75V?_,l6 ȍڢNJ,mQZUkhDe)U/cB6s.|tY!K'7cd@Vfl,߱Siՠ;XuLܠZyg?dQmAQ>jz~U:T=~V>LL Mrd*&;sds^*^P'"|KZB˅ ͺj~+J[r-{tMSHM=}q|ر6HPUm E;MVJx\x97<ּ+;hj  8CEGWzc^url' ~'\d~\e ꮄu uiE |Y^+*Nc96c8YlvCMc>?6D?[$zJח;ModMOue (x^`:_ͷbt8ON y)e?W>d)+,EheliJYF4k@s%gKUnzcYjk7b(ePe$'yo~}\ƻǾx3~yK@?+X(7J9/Bf@t〻 }7ˇ (NNj(lSS2IXOa4nv~O֎WJǡP?b!DՑNO8|۰/NFQ;_ yE0\-вF9xk'p'lM{vLnu#}iOғ Y~icOk:܋1cj诰̓ 3nVs?Ρ~;j~դQf"Eyp_O=#+ٗ&?3^7Cc}6v8ZP۵?R I_7ht'휮 2i.ǻM\\tdul'ૠNcյcB̔iU.}VnjBㆬ;hJj|TTb|^LNWg;YvW@Ȫzg?991L0%) l?k>Ʒ\@**͹E}!+tu(Hb~jM0b}űChzq* Z χ,Tz/}Hm-FRӄBo{3-I&n}X\L}<U.:M3+)<hFĂ;z;i^z2%0xV6:=^?W& >Zlw>,.,C'R~of)x 8tն"/kzIyޗ{]%u v4[Ƶ;.9k(wq @k9ΐ绷" Dg&Kw=:B@&o(M@d{<qx^T?Ar^K8l'mG>s:C?|HyS奄yi?LXǑ1!AK-q G/E`ēƭU$SPbK$چy|UF.pY|^:hZ)wރ@{ڿ(M ulJdӖ! ,CH1oq.H9w⎘30n,(v|@99"wRxJuaX}ԢZRt,Mr~+ho3'{(׊GPHJJ$dmm|W;_bG\YNH-`T)6RL2U|3Zml v-oU\z^MK 1ƵZ#/L.cij6-VOabwh^$s5D k Raa櫳Z"c*RnXyqotl?M%GmMCW@RꚊھSIbf)3` jY/v}5FŦ4/ّD01:u,l+ Q(x7)8,H|Ҏ|,s.~ CM)cB]|6*$nX*[>$C {Rݞʙ:O;od4-@-,PjG-!1$JpѬ<%cdͲ5 Z l?P[#j)jIĕu,*%wuOm&kVgR5n'e#U &a\_Uj ]:oʧʗb6t)8[*\8ca:~*lqjt}\YMjֱOzᆁe=lc6/fU./^VM"{UJgy*n-AӑkGl_|9L&UUgx-d> G+< 0DR"O4,cJ7C i`,5f@Z6٥D\M;>gmAz­|(ʷ"=:^;;pڍ\5|AƳl G]-1.w_Sh1-^(H'j`iW9.Ϳ9|2k=a|Pz8V /#0.a UGI 4}})EhF8H\;*cP///:hHAH@(x iyzGD[a(/彦j{RPyr-˰k)Q j`U^5@Xo&!$8L]{^g7Җ0`n mF*GYezZY4 '4] ]w{ݬ(*3ֈDaokث%F  }W<~icRI:myqNE}a[e6:$zAwo*_/m KiºqlIO.~<'8VmR7nzݛC?F ̧ã c)un3噺Ǻ{V`4ZP,U,iO3 ,- E?;-뙹&Ӫ? #ܕgaEȲ} L坦:Gҧa 9V6$ #ٍndռǐքabӉS\Ζ@77v"D BěD Z,~j\*k5VIchq{,GQ0f@S|%7Z:1]Hd3܊Ľk-kq&lӯ-~o(!'i !0 .2`S).r{ ᅬL#'5^˻M.obi^LZS y,XwSW xSL]əjǕdnFK"=s!11<픋!MI_Mm)8O?%u=@&d4z\}cR} Fφ*ùHȊ"b +6z3|!~>; J JQo ڵ5} +YޢVJ%-aN{Ak^ .J 丼ql gDEF}䬧.mL]&χkKd ]%aBTG ܨl>+Kv}/}ߧӲtJ${߫5+ :II?% XEQ %~Tm8};wWJw9(B0MK7q}G-rcwS~"4L@g._R; y2>ye,1 4B;c8 Z %ȀDEdQbewPY}w7APQ@N޿O>NlRD}l ,dB)2*T2(*@,@$  i|rro'ʧA?N 5WĹ{3,Zyҙux~VMm ®:#2xνꊟ&j[8vUo'J<諠na` g\˪ f^&MD=xLky e߿{.'HTVHL0]l.b!x@"6&DYwlEV}85~RlK+ŊK}ie"0yB(b5oÁH<6zwPfm(i6ls_Hx#`Ήs^+FF&eLc}RIQ9i5 "ᬷY}[̚RwGL^ŏ9:X^ Ϋ>lu,эQkӗEnor$^s k&ҏx٫|eU]whe|y̝e/Ïs-塾iҧU+ܶ YDf+m=>6N93T ,eIȝ^ 3mOi z8L7˼* fL"c=]uf5(,4Km-"U#{wg?;;JR?M?Rc5[n|Эnx gs+h]`a Mu\ZbcػV0au -5>~PyG<6A"r#IYm*9\o:,&ZuBEwCBic&ỳL^dD*tDǬ SjauvrFx1*6*EHZo\^d)+^bpٍ=~]JA9"Ϋ֘ѧߤzM@(jʜ*lyE?`in}:zmE%!k#짃QӞVkbO*_z)yߞhPbh"9hEHۘgweޗ Qc`<<)޳=Dko&@.Q}|M|FKf>3,3)cp>doL42)v ]]d $aYuし˜ ϕKKq !CTn#xIvz0]Eƭ=gZu2_)г`)ϹHac Gun/߀ӯ?p<,Xfe-N܎?,G^WJ Pjk!ڲc"kՀ"!hm=ξ؂[3{3PgߚRp'$ 7_GJ܀c@oA" IзWN({@U 'N{! hA~=aU0뵷kKtg¾vG9>9V]f\;} \/郍H> $kzbKXV9ZxNP܋8iW H8mjǻkE\]G ;'ڤN]h\`H"L0L =vO5Z[MRщABG!&!#joǻ:[Aʦ1|B钒ѤÇt+q=ņ |_`h- 1 %Ol#6g=L+ |᝕cvPfrMGg>uxE2=5wf;aE}S ]W8F4I:tc\:ԛ ?KNE{Z2yHt׸y|ԩ""ͻb\tTyՈ5kCߚ9#O{?^Mf;\Wmap#781ntNdH7NJikxn*}Yg`[8.~A|ގ7͔Ɂ UD Dr)]}TMѾ1>2&9p?~_]O\L3`H 1)h.=9:M2ѩ腓02BMs2M?ܦa菱/[:㭙ҭ I@}СwM#ŒnwQt5Lq%}oSޥSJy{I^c9$jZTJQD qJpmAH *-̒D\֧7-&$*]DM Ȥg4MQs e9[=zB^]OGmŜPwv)&qؘ.nQRW]m ܹbdSN+P3]-{gy}eIK]nShd vw ^N!SN6 #Uڌ\\٘~>G1MN-IBJ#c|ƯuGwIHh9y2vuV-cߖ־[ŝ~{2iU3#]6Z$M즤jm5|DҖS*)gW-.Dw;0_|٠H -z缫$Ю9.j:޾ hQ{*lqYPÿ7>ڛM\ Hz3jT>ު9rycR7yInMgk݅Ia𳪵[AX'Xʻ<3O)PyUq/FI$1cYOԧ+Jc8 -[;T`NZɺc*icR/^Atqm0Ma?C@ G^OI9kE dZ#We[n,.2ztzej&qP®viKOWG /o,;-d<7?IJ3v.#-Dt)NJSG3-O:EmňDHg::ʬp:meqٻ~Vu^>TY]4kl#ޗб%0A+,'˄А| `2ZmGA6_R1[ELRy;[13pd>+eXhi,c\Kcr}ho-"GZt Ne^Uk@2"?gG67Yd&2=\a;#|No,h6gizz{'謣^oL!@nx?*s<h{Qwֲ^HkLJ+;w "ä&OTٽ\J&sr! bn<&󻕬>wZ kMۼxw@9 kd5_ۻb.ʽ"LcY60Գ/Ka?Bb vjn H'!1Ơ< 0yp'cl0ڂS.Xb ,^֭4ؗ^%M.bVxt -n~x|k)j 8 º oyF@{(%_[4>%6a>yźڴηrii\ V]kkɷ,L.G>f^*ĺ7 m䬰wV4iM],d#?ɗRK,YZyk \g BHRkHXS,#tdCzˠ눋w꫸әi_ORtYgeU?C O1҃Bp>{jJP1ͧlrw.4{2M>qJO\g1V3 @<7LPwċ"NtCheK}hƠYCGO0@vgsڔUQ$:(llo3K$oP\.0X aZ8ϖ@7~Cv;\Y] Lx7]7@N|=,\Lr4ˏGT~G֎B۬wkI =R"bۘNWas_l7e[ieē.NlPM7DFOUs{{3e^sJYPg|˸T-0n:A寈`h`ucի(YُгWAV[gX_~#L[ <`dl\OY1Y[wqzsBbGLQ(>u<#tPqYX!c‘9>3 |V$uvP5PjT>֑M),ʵc)~yk(RRA<ã?A kis+!]sԷ',F{$ٳԵ/٬}b׈% 1#s,@[U'O[ Bq3vls3wP+UoבeKPLp7m7,I$W2/ܲ0̛N[7QieYcC|t ;̏j'ODm]ܑй#Zl[OF<6viGss+!a'SoBnsrlbÓKxTx}&K+͓"Om6D*N毬Caؙ1[ɕ'gbB w[c^υ{#[kwc>w./bQ7'urج"㢙WYۮҕ>yBa\I bʭS-Vj> KR7ʌf~WzJ;r*keX*JߥqVKsa;=BoηicBE:; |u!#!={Pq%Z[=;V%Q'zUK|tn@:h<]O.L^1??Z\wxBfwB=6tSY+ȔrН0y_9Fsp_ObڮRPP1ޫ);&j7{&% +џUuHu }Vq]9V*#?K~S#Jy6sͦ#'=J~=KѱY׻u2Fn߈P˽͏vvuOq9BѫU-Lկ#Rd+\ΥI] ̧u K{O򏕹0P*U͗|7Mr"s-%|F=E`Q`_uaXSu/R5ct6F_)f#$vpyj4:uXY+z_ixd&uYh?0a+?{9\yėf4_y}[y62~yl6Hbo@8ԇt7H&7|A ]E,;=j<鶉.{`]~U C d֗opLH0׫_zz9vz/lŵdgv,ҐZwT5f}쬪R.PU:[#:O~y)];C"l koo9߰U:B[7;^ bWlA>Kf^ 뼃PGʜ9 h[ƑYv2R*0j§bXGGR)Xk񰩒M0k Ƀ )zR7bhN.#x=L0`cCJR(bU`2>[hc?.a E>W]]LGnq,‡3F],eGABL{5Řޡ!X> Qon[JrjJkȪ>DArF8Ѷ5إF/mFEx]BWv8X`򿲮,vix.4,OwHIwB퐤.O rc;3%:wHNG19O&]A1[y7FG_|R'8xx8N3mH1 ǚǩ b|,>3l*6aH rZ 5rzy=D(q?Hg1 waN5+pMK,%0_ե\&ͭJa%>,Fғ&jkD،fKkU>seCs-,NJ Y_s9ovM%1ȥ+ϲ5l֟9MwDҐ~?;~BrŊKԍjg0jwN@\ 0wϢi5# Jxo &-á,fA|WlRY>M<_A8+V>M}nL.K^;&I"#8~vo/rRK'>٧$ѭ.Xi\B4#6J§Ϻf5SQb/ŭb2ԁ^Ey> r;:Xap׌3k^DqPjOe>{Cw#ŖņuOMH)v$7vhvͱmi]_{Yh !Rb7K|6NIfD(kNM$w|5ak!4:ۯEo|}O=iX<ܽދX ժʫGpo7M@P/ޟkq*cFSZf\#qz7'?svtKct'Urx9 Kua]SL!rHm<3߈;cQ#kֹ>"7 sEsSESI<,ws}*V<^VZ tF>]iE/52wNGƊ?j88 "L(b4MR0$L}wacEK"|p66q^ `=r؂_XGYF3e$EwX- czzakZ_f )QQ` 0FfoQW7ߧyU]V>U 7FH2/ KF2fQ6:1=2lI9A}d?(Fy/.λ`Dl% ^?OC}7_"Rhf4K$ $[F]iG5=`-W)wq*"ְק똓*.u_O8z(p҃:x=v[ :Ew7Q=i~d7x?#K7g|&l .p bχx<^s+FfI'_ICJ D{CE_|>\a3rR?3_ {7so7G(r >Bx>," |do )Ќƌxnt@c= z0Xwap$/A6N+$&ɥB ׻ŷ5L{$5r7AĹ+gǠUߵ,kH1h̆LA/L^ %ZMp{Lͫݐ/ʝmOdC:fwmZ= v hNC SNLt\;1hG0`fJEy F L~W ͕4HCI ]V,zϓaݶBI%Mλ}+ u3 #9̌B4"d[QF;hba_߼*H{X6 UxKU}h`fo!(Ph+Cveo#=Y !GusD9p1f?FǍ~lҎ!vev#4uWwy n,LW(͇4gxB+YD"=%z@k9!ѽߵTɎ߮-zY:o~!  +w#_vrЛhGwɿfF6vڊkayu=.ś6F7åRX5b ^YԀ1$ĨUL"QC n!+2Ȥ_qMQ U|Ɓ(ƣuV)_[ҀF6kD_0o&swwW$Bc 60ab4]^rw32#%HMJ 0ȉ؉wC9\m!s#. ZjW[. SW/cŖY%v18k)AAɛ?ϿS8dDWcDeJuDL`CHh\9LR F~ЌG߽vo I6`v 3  ,0zJxVv=sa'V7fo6C;eyskZ+WÔ=*qSlqemF]A$fuㆳx۾Қ=&on#t;Lbp"?"-C*HJ@LlJ?TGkk7:yVh܈/ dtH #4F"AwX`j.ɫ삆b$CR%*@WԵ4'(2F͑ Qz"̤vj檝'#V=㡺{, GJ^N}':}x(c C<vtr`fȨ-b1cʇYï6v_6:/TQ=^3q0p(9"h l˝b  8`nP?~`4gwح!nv{5W0ewng=Bn"i Ow}oA{(F "@ꮹ$D[% NTg-{ZLُ>'xgb܌ePFX LHŋ{, =fjԅ-Hщ%9n0N(ť߲@GIGkOW $<uF$=FP/oѹ2^0BOqoI ,ҽ6KɌoK~WUaʦ% ѱOʕJCo}O`|iH2(f2Т V$ U`PA`E@aV",PXDAdD( Re,EDVDA,"Pb EUQ X# EYQ)PXDQQAE>R#`PX(PR*YR*|MPUU"R *"+"#*  ZUPOzsmq"" >ENI nz$\zWw70BL1 ɋ͔2BJG!Y^M7R.14L ro÷K~<Aw7aL̺:M@U=ݾW\t2*nD(8TZZ[[ı%dn0gE\&0hGj``TJntoq'h.hk*pF|@^EY-!"(#I Xdm\hb }5tp0K6 c"SZ: e8'I15Tq!weɮltv|9LUĹ[(>4M1WWԒ")/*Bƙ/Iե -L5 L5Zq\4wtB^ϙW?n21_zэL! n(' dC, My!Lk;֕7vr0*R4o:< ӺDK8g a xyO~WfG;kI}qf@ǯç9aFۏ$wm l~~bzd -pf?G&Y{c떫rv 𳍇g;EEw{Z}k3Z [NpcP߭0Y-!x阑kbK4s(yWB4Kٺa'WrrFf Z۠4}/ؑv0,$LhJPn{ߊ9ȷNUbTj'YZoolxO޾&^T=wE=ʠA4 iH .#B-{}r pGs$hF(1ctﺔMa$6"Wq( Ċ'/QUuRA$*q &`Њ֙x&:W!"O?үg=tw(Z&$|sj`AȥuۨY鬡g kVר^ tro[·պgd:[>/n~nuÍ#wtxx<;; Ut ,enzcg}&`t5$HP~sV\4l O@Ӊ3Y͡G^ŇxBsm/vA.JGוm7ܽ[El3MSZ+V.[ IY(ﮱ) \W"LV.ek21lVp"t%\݅Y pbf!@`Ȯj3~6V1\SLv+ Y4UdEC>?pmû89o_~2兂ݴA<ܵ|{kD5TmCXM'-"J O).C  ybW4C J3|y5S m !!8:qBQfFq%X+mJ ]N:ɚe c?a6kA4;j CGP?V9`SngD+ >YL^xIuّo =-'Vš00E~cߵoʯf3l-u51Ϋ{dV5Ᶎ vЏ#TJzy ?D{2v~Vs/tzH=M糩tvPm"[IJOg~v'55=30؉rUArPCJ`t>iy]SZyznD2 **zY|54flv0gɫ.ӔGC"Ěu}inuGTuƛ;.lv*#S$gᙖNk&#'\y݊EPl_jv6{h%{F|M;01$ζ[ÙYI/;UWӲ= TzA&c(DIZC|ԀiL9?~Ǝ.'Xy2γ`HRGU&ƌ^S(%ՇN&a{7|"<~!.Zv1?fUx.r6},yR*~qxl?|HOzr(OǺ͍RQ4T3 f30Ҫgeaki١!IV#b |9`tFmCp!gOD}q_I1 JUSFpiH,+ |F-uωHDl=imP@t(ZlzWvݶ'߼2Rb[U|;k9ej lB("4yTOH4 j.9f9ΙSKQO oˇPT+Qo4˜ojʢ㴤bV5,T@{7ɂ[t )a]Ah_[R_}`]8)vELYREBRw3 8MH"G%:F:IgMͿg*K *L.׉kA.3"f銂fΧB5]fk@#6Nk<٭O x9F'rko=D.[6T߱iKY6Pdq6=2I241b,F')wl /Fg,[@3dٹOB](wDKl4T^f4!zRS} Xff1GBI(1!^r-K}]x#r&5ujuY\" _!6Vwѣ]B-h0؞7bS0)oF% l-n*M |ۯQBaii_ _j76x(Tt}Jz]w}˓i)eH(CNYb\@@]W"$ K~E{Y#RMgjƭW^}^eB~,ձ$>;ږ\CyFw@u^7O9E.(jhѡOV;vcϾtZ=Dy]hN{+䮼69DwL CInKv, DCu^Ԕ '{P Cːk;97:ZbjnšpWn%t)ؕ9u2k玥a d8B=J]0[ͳ͹Z1vCJ ޅٚ@U#4.i h fYЂdޚ)`Sv&d M3^Okgp:CG$9M a^#HQρwUrwmEޑ||f#F^J{ oo՛O,X3۵~$wYJn 'yٝ9aCGVq]"ͯjXy;EkǶfmf&e] 8]^{AOUL蕋=&ahxO˵GM'f)FCKH MVhq_ס1cE32ѡo_&Lf?l8 굼pB /H*o7#kd$B 0y-a02?Cz@vNv }Xe6vZ-6ic॒`hIg :wuU},o@,#- |oE r20Qr[zJiѸtvEFTlC \-J67wh_Yqhb=[@g҅BS;}Bh^ Wk]e7&=c=gB-R;@z("g~!LP ]3eYiO]lX_{ljuق/A'yZ;RV 6|!{ւ\p 6cRoH~vjYm3#t]!m_7ċqJLDV._6pbQײN"`DЮ/LPc_jRTRRFî}Cm("2 Bw>q:p4giqH!0f&?>iFI?R`ɶA!"Ϊٷ v`L_O:(^#m% b˙0$SK߭E ,VRX'F I45;RhLI9k4"t\rdj!}0AO1vy)L.ęH96'>J=ZOa4"]Wٵ}-s /:,괡NqW>3q!5,l K_[pF,ek\\Ɯ:_}tKtt[iup\boūE$פkUwW$1$ky7V z~$ޚ $` yiRۣ=]0pLҾM&Q}S׹ݙ#=9prnlp`]3gSZGUǜ"yO2>;<D)fޤʨI%%6VZ慘U' /p=Ԩu9CSzf8<@רI֤K򟥔@۲a&xO U>tqx{"MsWűҦ+3{h"55.O>~o.58 jUͰrXY*Ӌ;1-K%bж_Rp@ 8$gPjo+/q:-!A vMu ]v)ϧ/)<+$dbW=Np쯹n>7 lU1DF-ʹ:-?lKԂʲB_'Ae Z r|OX,/w1b߁{WMvct&`&:xmgz(})c<o2POhtzhnaڹ^ۏ hA~!P0˜jKaԿJ@@7I^32GĎxńA_xP{lm8s]ŴhFr~O1D }3Q_!>2^NAm+{{Pmo C?զKYFT95JΝ>Z7i>AW`ܙ^~ %nJËSuilfz3F7Q) qeՔ|q T?uTϷp+x'αU37=p'vA33>} tBbNy@rЄ! t$`pr?|`c?cə?a ?pCPI}apm_oUE#=SU9J !X>KI^ |LD%~'PGV*8ZuJ6UQ6";F Ji:C aIM $nlL-1 $" 9\?sPאJ^+ (*JYi"%D( BQEk8Ōor!s^-O ^ M[ɕ @%"lAxBn_ `?WںXكrf3%͒U*|F'wJmM7ȓ- 759x.X#v1(vu:>CsN BE& X#2HNښI!ouk/&v3794<CFzw4l[/1OS4[M 0Ԇ횬<8yF|J6-ͻJH wGX3fa:j_cX%f H!"sm%/J<)6#Z>94Ee:Cz'?Ƨ~W_rHZC'ݧW9Md2qenS\jrs5yn__?^L olCzA/.GyaI$E7f3ThagڎiTTqx.Z޿eҺ.";D'_ٝɞG_:՗_aslv|k[xQRUc9^5eW`m V_R!Ʉ/e\4OQx7Rޥܭl}yxSfkv"-لx}jQ{۞÷dԽޤ}uG:"Bff]{w>1z$L}(ԯrA@i]N"gWf]PX6:ێNy&&͘0<<4L)?_EN%)zЯNXp"t y èCh?w^87s5HhcvPCGD'!,1@zN>S-!U ]Ŝ~ڽ4HTUR .zBf).%_'xPͯ ͧȊQ#Rozá,oiƹlgv,+"=߉ լë21`v桧h_[ߎ^z댯/=$+Qߥ5/, u88>WI] n yxO1ص\|>2eSC(Ѥtd>BDړʯ')q)2~պ]_uGg#<%۹6ok5a|J p3Q/ ʢ:ɖq拣WJtz~oql/2nWy~3Wurp7~wȕkHPK^ KxUe>u9S迓Ho4zf o#"Kzs(+?Y,ҋɌ(ҟĠtiGG^)BpdVN4, w_0-3)Y)BDϵ)SguRo\ "\GN׎hU]&Y؀x«JDҫnE !bd&_Q*b{Ky:Zc曹 2cm#hY5‰[0Q` qf{Uo3ɶ9he>m{o}@)3%PENew @$~_~pI; &;P2ԇpqb �c>O: QT+}œC4cnٗ5ل,3/t>RjtmMڿgOB|_ņ*cJHXW\9B }paݒ?͏Fgۃ/?l}V_߬h@0 +PO6$CEnmili3̐|~>:L話tv@* 2IMըd_}:ˡgMJ%p" )!a7Js`O&44|ϸm,-Rt?ၘz>l*m !jif>TQݻQm ϩ7's>1GWfz(IĽo@Ě(WΡi!H.df @V@YӇBH,!}Fe0睋()绡`-GKg)(f ]1!zYH!TJ`3PE((2^Z+g>u@{Lb- #&}ϩ0zZstǦ4ϱ V-ƈltm~9X>rT5ƴ7-M sZ;~Bһ^ĨnS•nNE)&EvT*{u!k*5Sa$.evZ3y+j4@'`( -$Qi]ưn';'F|˪5#iON^ jtKȵϡQS#z h) $ ɝd^,;"i4=:( iH  6Krs z 2O*3EɐBz"Ǎ̰dɄ95R24Ď_QnQrtZzvTd /4KA5FKkNl 3hC>deD>Z&jӝdp`†_Hˉ,ɵe6Fu= ڙyx߃eg>]7nz\®'kE; FɯTN (|f_lqug-$SX)OGV\7[Mf+] )P4{NNS2 A|X7[n,#vKZu7kJubTخm|,; ?y޻3Ł*(Mu3B[FKY8Kg#ZԿۧy\|+ t/kjRkD*2Iof^&׹#haQYO\p=] hv]I[A"ej0fb[-Ů_e'I|z{i[ ׇK? qZع#PGĶw[mi: sz(JݪC\ُbCuG;'-Uw&,$@}.m;=u'9'7*{s{N& Q&o^F :CZ_1Gsw|e-ѕ:yz?f!\.7T[0'/o_ee;!ӭ mq!ȍY8>!.IXƤ6srB42+kٟK2v>󽵲vXKT땨[;}hiT[krdP`V.)<5Xp J@:AUy ^22aRt!2 ކ[f6,7᮹y3l/Yyvl T]F@2j0'SN| bw~Kl5ŹZߛ[1EMlQ(T]Xfa?.o$F`b$-mB=㈾ΆHѱII7VzvDBtChˋpOK W(B ő#dB1ID=ŪyJ\ڶ \_bp1is ]ac {CZ0O4P&햽W4xQ@IS0At@D!m$EdutZ1Zsw6d4bQnd]vKn \)k4q, +R( :JH疭ƸOH2Ggmoa9I$IûJW߉WduFJOoBY`I>DJo6>I)qAM% ^(I]/<4TM5m]6p)*JRU2@릨}5/jS>}>=M_%vRJ_v^z<%I'O*F dffZ*VQ=f\_-&0ZژۨݠIŏ)PT5) 3|ϬG+M}^]\i~LU3(@$957Aiܘ͈Z?.}˄~2#3l'w"Py_rB?9_07:EGXJ5q;x c6!RVB#8#F}Qdv,@&Vt̏0ӡqh lYGmEAQpj%nA? !wٿ];3#h/~^5ZZI}Iu *O62;,@fP''$]'̡t{ޤyiŸܫ<[([т@D1}F(Wߐ>ޭsƚ5).:~?gҗ"u-3m.:?W_`zn5"]` _mۼM"3 `[ g3B~$8[h0e~[G=gCCѼ'xh=Gݕ>/ԵJaZ}|J;3H1uhyKd`uYT:d* '[3!2 c>_w' њl.Bq ;H:l(59WB~ I#Okd WK bAHA@C0; P?j`Oؠ[Ha&xXP>N85j,Z 0yr#Y40(MqԻ3{ XW-ܱh E&aߙ((xTUiÍ'j,:)*$}JeCAdH_ t/Z1n* c.j?wm*= Z H?g9OY,lwl^AruL0- Dꞇ)uWmg6L~~aBe?ս2M'gŋ{<r%3=x4M 3)M|5x{#$F%D@B:SK3shja)"L^4gaơ?'0$HB08;.AL߿k^Ў'|iU*`sJ>'7ߺKSiA V%aRϕH%1y}z=HY Ns$ =uLzȽ 9U _xwOНb~x3"A P|{ o~mœ0A;+(֞4̲jy #jq1;2=X0w:a hV8H.yZ1YڢI•jIF\fc$iW;{4lG65YwvU|eX,'Msv0T=$OEd0k>돼_QFCPZي ՔH$OXaD %i~t% ao_|xnz6FC#/{r3ɜI~e/JHTO9dPCdYQ3 X1CD'@usEY-^|Ӯ!~1 1JCwG:g,\~oS˼(VU0v4oFTK%ĂP!Tg%vk{&3ox9}tv7D3O.'ˈƦ14SQ~ǂZ0ҁڢ1~ۯA8o1nUwv|8`)l@Bxvζبmc6!qrua4xE2Դ*RkeRFja,먘ܛƣCb<$;ܡYoE5nHPdC+/.? ӏL3evTώɫ|EyɌ-Hn!2->J Mq VكݬFII~~g'[dxuP7z$p8j)Ӧ!'H*ݎv-u !16y ?)w=5QlV!x-v} E poWVYؚ@jHwqۢIјGFMJYFd[䍤pb[YgI: aboycyKMq IiM M z9셈pp]J=i]U˽OuF9~] L}I1ISX?nd2!-4!& }l*,GONC j{d1!_;)5z^x5F+f[Y="/ ׸m$S16Ӈ(Q: $ήk% !e-.Y~1oF(s&qd?}zJOB2yphj6(nP]]4h!o$I}{jrZ 7-~L;KY d(1:j:z :&jL3ac (m*ICH) ̲gAaSʝHpXt!AP(dJ3eۜZ>,èKGyaY fAC("UB+Yhb`|X["C0'.yF&-3eufbyeqފÅIߡw7vbRMraIcrCgg*B1%d XOSD12CЀvMh#8a( 'p^ 89h5%.%*Υl# HA(`C^wEHp-o,4 mW8#Y݈gԐ m7y}I&FjFݠzeJ*X0;9m ۇzkuK ׭9q򓣲m{I0T<?cEHk)nj]q'_7'c`Esm5Lp .$P}WA׭UB9VhF8B%Vր]M2aei`<Sm!9B, 9.3>g"Z*,d 01;Y3ud55]X%Y-NT!.qXg P.&~]<?J$B\Y7&Fg3 [  @~pIdQ Q6=3Lr,;ٌ v-f"xn} T!ܒۿ b6 yJ嫖r"I>LN2_J߃M$߭XIэ (MpcQ**뉭R]kUѬGvo qRvN !& u.|תT\Q|m$1AG,LKcJ쪆ԙ}PR fRp.Ebni1۝bLgg01(gD8ngZSdtJtæ jtAk&lV)=DXu!#̻[Sɵ5k֊C[P܂陮0r5,XJJڂr*. SiG-AQ(Z]IeaێZ A+nȤ[01=D$f  #c8UB2sIi%BQIl=Hc5& &MлDgkJ~~H?H(rK&6pSN8Y; Bt8nx3 vicצ!5+ycR"6ɐ.Cq eСVX.VB憋xVg af!/<1[QΚ}2g<O'H byACr^nKYĀ$%PH dC*dbn{1rT9wB5'Rsq>t`F 0t5'8VOd!Ҕ8/Kq4Vx-B;:Z~题ЍqHt/' 7͏eXt8t,z ddwL$/WH!ː"4ŷ_\@i^@('w[G߼@C 4r|_&$6>= Zq]gLS j+R+X8et=FHƄRFi?F@ڇN+y, 5[8gxc! _ `#h03RLv X_֌5K@Ç鴹aUsFQ\Xt&+8͌vxG3-EiMFJ]Pǘd:6Qb>5Z,rl%2@8( {AEP/1yBtyhZd PWf:sG0w.>}EdXŠKP vwHO4DYZp^N">Yj}.b23˓a=jdDBe$ff`U:T^0F '؉JEE <^z4! zv2dE!XV einH˝hnki hN}|u]U0Oqq) ;Έ42jo`ă:15P׈DVκ~:h3hgB2Arj*L'ʪ)!R@tOFiP0-Rw& $D숞%<soikǧFu8_xЫS1@Fk%(ZV( cC$[ኍ{fI͕*[c=5ԕI1Iڇ+=7EqHHttHR ZAk1TDڗq`iamR0!OE|W_檸5zF:mSE2 [΁'' #~ig7 ?Nۚ-o r.z$GhKE=۱S'BKr9M?[" 1O^oH޴10uޅGu[dk ZLȃOy?#E:`օ{ԫ,z ]Y*00xBjUF電 $Q=nh7>Z[k/>oo;(c ~i5O2xD6'|yyio{k'l}G~IKXٍ=tSq!(=5mk?v<΋mWnVޓ/~#z]tILYwLUyk(q]dkwwAh~|ǘvh?&mG6H\YG~jٓ-1_4!ګe R-Ȼ7[R wٰ вJq䲚3mdِήMK\˳{B*r)(S& %4~l*[FUKD}ǎ547ts`׽'fX'"? xpkcX/3v8S3`kkM]SDk*#m cɝ|`,v ( kt%/fy[n:[-˷l'h 'wqQOj?BMKӋ{aPߨ!h>fNǨ O b1|i ~7v0dz6ACZ2Jk懱kW-ck^Դ?< Bg!IgA-T>ž tʐ,l!ACJ6;mσydD}'sڝ8ړt .&ƅ*{;r)51$ zH@|_x$?VO?05qyk&BSl< ->')FJ>g7BZ#36AwX?c#3JU=bx^4]БYHU`0ye]&yn=SeDXE)=__g>ҙsaij8H2虷((pgbF`3SuzadVF}H@n w3wCP!1lE,idSmMEy>K@2BtlojNk[s~8~g;K:Xs7rrw)>8"M1fK ڽ"U3;:N$8]` چ/p`DXjdC_RW b3`BAYGgƀđItf t8)wwh-L/!ȶh Q(_2ZR_DCʟg޻NJ@; 뾃 yJX0>1Y]rc%hDCqCi[DOǍyxJ=,0@߆'O`pp; PIp_>#l.񏧚gw0c8 9o;!1v!MЙ$$f.MOT?Q@W'J` ?DLjyc>if9mV"܌42j]_P4/XJUGH=/#oF G[:m,o.y.zp9E"I |9W•2vN O!^O$$R]>Nh PAq$Sγ7>i CV2&&lp<kٵm3}# S cu}׼x%̓jBLΔV7t)UlvΈmw7n7MzDwP\zR?i\: 1ɈRMd.Z Ua}dAy@j⿞Ŧ\8xd/SSoh%l#~ Tڜ(XL!ۀmoz(l)_"}2ͣ $ڈtveEy5u,^,'BDhܤYBY&n>d_.n죍EzuȯGh6E, Bڠ.{ GNz̟L;R)*c{_@8̝ޟaPB4yۿ՗ZQ  U f3PG~ҙc8>ʓSg.x}f~ΣYgLC 2zȀcO36Gdzo l3>{ a~ L:rx&)1dDRT u!<38cj91 iʖ5ޣo=/#99FjZePev3\3 xjj[uzI=C\d ǙKz4PE^$1)xlOxZuu}QL\%1,ͼ %2&ZE?k-ɮkH o"H;}<5k?K_BtY0ׂ8l-7{^H5_8LUL$x ^ (tH[V7lP:k|(W_kϨg ,bfcD\CBF}F\yQ6Yk!$=>ZIY8߾朧{2 HkNʬdTIDيK^P5D $EvX;t@DQw]@ v1%OiU,T 6@} 0&a*+։^na(Ɯ 5d"" @yӠ3Z b}gkeBDYĦ4GG}S-[EԹհѰ^\5E{ϯ2ySXקcj@UTۋ@ !/|Gifdgc%Fm!3 LO@rk7ɌL0EЦOAS(E7HnYdN΀da(f7,1S,Y-*^ ݋4A &N 6@Qǒ!U3h`&&Mkcc4A֬嗕[hB+;?Z L %okrرnͪ^2XNS-ƭ\Rg8;lVʺhm D@bg6ӊ"u{s[V ݘ v -,WVʱQan-NƸoN[Z ՄVxP5<]MeuAV2L-;:&#ZVʾ:b 6$:zqk4{H/w,j 3t@%t>Y:%-)o #1-[ts\Wgx?u= u"&[m:6NWkv<'wU6{[6fiUR2cByسEOxuW#rc9b q8;S(Eq'Z'\wzƑ?v\Z+OBLz//=^S ]C}R'{#a >:2gUcnKy~=aM+KUP_՛n}Ʃ["}f gdf(x.=񈖗P%c;jo1#T 5 CR7%ҟ.C4w9}+)5rY8 v$A Ve)" zmO-mAGW@uB u ?6uKGT+&LB HQZf\sl"t= dwoã*ӎ:РwB ".4hDf~@57ϼ?}1y^o\Q-/]0[R!hQ8-`ޔ}/ i@d% ߚPM$n~%((rODDbt㝊H@ E8e5[s$(d!}uE@)I PU eJ3a[FCŚF-xsѻ|^x`䫰aU* D3 _@q[wb&Lh2d@bh42 hLѤSTSe==2OSbO6FSm=d#E=a0@LFɴ(L&ڧ Ci6OO )y zi=GD3Sh#<ڙ!2'iM44h4z4  4Mɤ4h4*{TߪBS3TPzh G?T4hzh4ѐ4JDII&iOyO(z4ښzAzOSmG=#AiɣOSF2=@4=OQ4 4d2~"P&$# ie=O=1'hOҏdddOz42l0zѧэF5A MiM14zA2=C29!ri#-0{蚏k;ޝvL13eZу .s|gmgYhn\`` 4Jދ#p(o32+[mAd?EnD@!;otBgZ谪$"Gs>Wtz=9NӉI0~?adJZ"XfX(١bqz!G˪InȚ'ZiD;nФ>?0f/0%vXM5fVb wK@JR$i.z6 ihx[O1maK&E8 ٘NSq??z\rþ0;sÇ)Ck3Obe:ظF1IE2y\ >>\T@1j8 @lg|^ 8 fWN+H#ÚZ<&˦ޓ0E0=33_}FTDSk{^l; HD)H RtyE}9ojS0ʋ4@Be8evаބ ak9㻇'*٤Gf'6wfau; ( 07^ Nߵﵶ63&R%frcƨ1w۽&L@YTM$wzݽg~Dnl* L/E **Y/ZFwL fh(ųfȡ"h`am̐7D I_"E+sX 04!XB*z|fN;*CO!w\A`[a t7H9 M%sf$${ED kkm6Z׭e s|hמk:IQ}lhӰ5SFOZNiEƥq5e-zJla-3l%5эp aNj'L{_IǦT;>4h6]a}0 6=_'+(R1Qeo+ M~z=5,Fӫ|{{?MLc{ηس _]jQAl:64B]+6в0a6aa-N(ivz.hq僌L [YX(dXcJxy"y! ]5Ǜя`tBjdҸpɄC)QVb"lM}[KtRV$+ )WI=N΃4W~g^dŭ&TKJX±[`T; @$]c:N4$=mjsSoWs9]53i+%nM=)2;ZfYRVQrnƖ5'i4@^B?g,%d8d-n彄Ӕis&bL!mS 5L9ʌGHMp.ĝ#ˠ˨56U4yY)W>t:[;\8juKfab&/\(P)D=^aX Rsp81q xtK[)P+7qJ6g i=r8:q2u!a['6;jː.TP($$, t??TH`Tea!b2)<l59Ιy􁳌P7} a fL#qeA7ndDP5::>'oWbdNՒc{0FQvyXO?v`rsTsӱwGlL]c8ҭpn)s2:P霸NPB*Ȣ"qềQ+֭‰px0NAH)Ղn754psemp0FTqJ.,՚sxr[y1:q\iǚEdF 8ha 957@dy7< ]h)^0\Yxk!ѿ ,Ŵߣ p_@:pp@`+r"P\r^> +TA֚kl qlK Ɔ^bba!߳pγMMo &4o7ʨO aA>IX) M^.!i*) $8<)ܾv8o1ͺc:Ab,8ked:wׇP{4Ȯ㏑g&y8IF9s7Jѻu> 5թ$:&]:Z^aH]8'gO fXhsXeZ8gïdaYnm2pH*<2!.C( a]f}k9hnX"'B4Mk Bɘ1(ciA10eR:awM`fct )97O98'.~g7TW~)Ͱ$BҎX+/aˡ.@1$QS>X52V:FCt f7zp9Sx8QN:OE7 (I{L;:N$3L214C31M;աEӈ!A8AZ5Ψ')Ѣ$OL.-%+Vsb$p/xMEPi5D!y+4jye&b$5 +zHf]+. U,+F(8D$B,^4Xe) "5Ȑ)Li WA! ~+cCIhWMTWF JS,\b"ѩj(ITȈ帺dЄBWf4dᆙ+Mqp܍B 3 r aH ΅])6 K"&vsk^M偳J9Ul\^RZXa97v"l^$XK$!X\8aeR"KI`LUR5xPÁw -ņiH 1v/d& 004 hj3&̓QSv0a;ˑX<s.q6AM䦎tΙ&tɢvwtC!hbkxBs0{(MK'6Of&U.` afPUMS h,AF MiDX< k1aw2RVVjMPqftSw WV ] NA]5! .""`k;ZaYnMYؠ"l) he)4L2VVEdSFl2lCTM &dU, ̓q!XAI2C)AHMaAI3)H,$dH*! Y$ 2dJŤ^ /bD$U\A[+ h2ŋ+ XERAF@Mʈ)ЀXH2$"R( "A>t. oVRAL|Qp#}BݲJ9y~if] b pkf*hVBtm`vQAm؀۰BjX?bDD6@E˖*,Z6PQN " *}h(v0D(D  !HpdC\0d7#*(IȨlm*mBE$KRE@T@H*!_A^ mO'lypDD0y(B*^&c4TQigt6UM$  * $Yut::p\1@(TE" Y9];m6P."H "X,XE,QT"+T *ET}"1T}F:lE@"B+ 1bEEb"`TUX(EFE@E1V ňQPXDV,b #UT!!茄#4T11G65q7RBFJ(~2((uATUUUUTDPXAT"b2~7%RE!#K .hbvȁE  7$3:R"=AU4"rQQ5QT Q @TQUCѤU( -#pI2b*A;NrDuq8Wo0M t`wz^}*n AB2v}uq$|oys; !!)4%E&no;T~Ǵ+FA!(,1d`FBE AdBOvw;X.Š~ TbP`,TCHk2 ,'4BAH6 #%TW1L8tg *,a17GER $dP:ϖ{S):zmnUyCp(*Y"= ))LQBIDNHkFU`KXL0m9(T)k5Y͌+I/~#0JE݋XKbT nfC4 0L(@e1e" HL6 8 )-H)2F)XqVa.4]++Y $0őH* PV-qjP#[lˆaXTPCL!$(gszwzンed3鸒2u$ I 2|#jشdi\3 Q2\AN+M}uU\X|W iCu\dkoo<8!m|; WXtbގ35PiMSb$Gz`?y*N *X*&hiyU&|B_sMRhhEdCF:xݳZY8:SRD׵$sSu~v=P Rr0DEb @%;R CR$?]6483VXG*̲@4$>Z = ]t(kCB5)m_wCGFls}>q0M| x1ٮdbMO711ala9V2w *MNs E rFBEYD^eG')水ؙ379]G~^ACY[?ޔ@!8;L߆fR]t;'ʇtE@'$SN c=F@DD+ ru^s{׭]}ro/IC``JG rkZ +%Nb UƂ7wӒȇ3@#I{+aAlT*BIĐ>ɖ Ъ6 #$ sRKqS"U(8LZztj",Vy%nI,P7-5܎箫^ymݔA'vNɈPNِ uRck|D{I-T)F81)HEHK8^I=s>sɹepHh|SE.;c6w[{t+M.Țk.Q*yު&=@`c}cxڠLenvK[i.Wr|ԃT>k_@ ~qiOHf^Bۿ]Wx봊Y=bw!0 A"_b{cIy?ǛY 1 l}?"LI.΅VNLEt`N$ĕxݟ_S=&Lֈ*sZg`omS]B.i>Uh)9 Y4LT<0`*'?nRqrz6 Rڟ M7%dzZrr30%VNyWZ3bY9Hs75Q3j#k]u3? 嶂I֐h?.=Vi`";rm?=.@E5H-T$nGmD25YpL>ksR3^/.EH_n~Ѳ[[ <䭦GBsk&q>VYb?GIDLb^T lU>]c}lȇKD6yޙsE%(GxQ=YEsb Ѱv_/7ȷ=gJ,0BXDL  @YGPQ ( n5T2_;Q;b `nS>5ՔS1j @4㳡(zIb7i"Jměh[N]JT1 rpUMTJ͵@S(@u`(1T=W(T.,8p‰0[񕙾68kH/-wܗv;-+cK6wMUEO@ɮh( 좁q28{1 Л0raBD:Ȫu{}3-^"?y{ڀ&ns])b!#@ڜS0vx<%QQ?ur~|}ፄnB[Eco7YK<=3Өo` kG?{5o{v藯ƥusXdhN+ZY^- xҵ'k}9>t\ϧZ&^r/OBlBPxz:rbXUV q[N3,ڜEns_iv>лS;l:dv1In&1kfwE+xǢ=^4O\!(_ĠXWMsR_#hzudן,jlv+te=E/,W1x +cAgx٩5 bLȽc?֞|Εbn*^Jqjaz$ya`'-3It564ռ;61ƪgLrrM3t 4#`8AG@`sӾp-V5w&|N&!|5ZXbmL`p0[5]'v,r63Ǝ)t 5NNfqLpu%7sIZg@LK#SgY+@S@91pΤ;4tCw/58y9\[488'FAN#6TQD(p"tT\c )AaZ{pd@PS-w>\jG\m4QC*kn KyU+Tno9OlevYq>Y*NJʟZN9[Σ⨠~^18O|}26N6Ώb X$AkbF!||l}#w87x3LJo_G/`ؽ=[iaTQ0L(Y>wdt^(@+N^ ]S 0AʽyDo6/[j /; hSoob[SvXw5ɮ仳d?B9u|JPb  yET:ͩ @a 'f=90yӜjʛ.gƂ18y1qyr*nd{U[n騷܍16z/P*p%V9l0F*^\[*͛o-Vb0{Q{NN-}M|#ݛDMt?m5o2nTzłȍs.g.f3Ͽ6Ѫy\qpBJmeoȥKfUibDU~ю-_֑vbƨ S ]>N^B۠5bӓK :Dp]#KV).s&oco޳27k+#C"p3+cyۚ578Q&gā_nlٱ>UV&|a18oo˓0Jԉ37CtW$US:@չP7s~\BɊvi"tp,efInƃ' 4N4c<;~?Hif*\9u!r/Fs|9(¦t!oru߳x_UUP?7ijR4WQ~8JV1˲iv&).ն4ɮ´<[ SΞ$woSY`u$=?ƚ7goV(ߑO\WN~jE LhS'I|;5*{̃,^N]vFҘJRD>.Llto6w[! GC=swK^u0|0.vZ,X@9~ŗ*t>Z*4]_"85 8 E21\q3Lüö3ANJSskzǐ,"?TPMA~_vηomRhl=2B`3 DQE~ bEw UI[[0Ηfc=H?VSFא #Ґ9s|{O==i} EQD,R"+cٛR/UE} vbg(XNWɆO؞,ߠ=w5gg=UomU2~N \"ah|+AI`uAP@"Yh(10D_B?~{xH,`(bRQEX4aNh3T`Czn@{apv0e﨡?q3vY3ai G" fRf#u&PT.B0!܉Z@8g@:ۗ53XVFGfӜUEn vsv[.dL9t,l[Վ[VZJ[%}?QkڿѵA|厒ޅSjnX tqkw\(kf6KnnT޻Cv=O8w4Sj52ej̸Nm: -y @3r>Nvoʜvnҝa>4n$,o6wXώ-/k\bv!_d1Mjs)M_ImLsCg~RW7+ؕ7(Z gE39 g3*]d)%2TKܪYuqqe?Uݮx \xa^9)|D$RDSQsqǏiP ;I6DU}s9[S0M7e['GF ^V`kUwmZJNgKoV? z{D]A:."d4J5hGƲo*㞪ӧJLX,H W{lҳ4~=VP2w~DOዣqYc>UK6X ָc@I&\kQU__l>ۥ3JX) kSv5[W)gB0YљַARζ&W[Zww-hBX$ BXC<1pHJ36fjqBΛC3@p5hb$#Bn(+e7lYA1!d5I{?sEwS*~0' [W&]N q ާ)#` ZL>rld<{@dȈia?y?Cy!e-WXnw46Rv`%8?ӷ~69d7銠u;Z@U?Ⴞ1lV'=ZCq~$ 0j%@2uP>m,$6-W`&Zri7CED@6x׸"8 :%A=ŕlĪG [\\lr|t lcN^v >!&g4>Kw82%"c3?'hɏ"V) t*uBBU %CYdM׹,n-ۓ (LuTpR*J*Wͷ.ܒ)BI{u.Gt8櫙OT(j@qE=,[C 6b);qw[Ӝs||'̜XiX".jy&4Q@c-%gΎ4EŎ|T]*n/d{WύCzr9 o>QY_}0D)82L[=C7-ZJY9{VH.q\Q{.v.At.Bwr8T2ґY .b)BhD!.oȉqq5m8Ozń<>-JrJ}o뼷-Υ}N[pgbR5c ]35MM86"hs&W";1L$jE"6iD V5d9l=Ƶ؟G;P[o?hz䔗4\K;s{|y=A>;?/wzNR(nT*5'JU.}9@ͫ>/j,iQϸj潅hyA 5Fiu :<<)FQ[J[ʄV8F7@|!0ٶ%x!_8ȁd 8z]#JELM6bhӨ!Ⱥ}럤#] $d:Vf+ &TZ6g*k .Ք'd;i94jJa cCo *2?sZ\\k><>c|E6?t7ͥn&#OA}$~6oӇϲ(VQ[~)sXKnJPXu h za ^@$v.wV7FDn/ dɡqv­?{ǏGzjmw|y]T5w6p QK0`p <|,Yh]|:C%H$Ddh(c!'jn£ޚ]Mu&C7OLn?C~L %O'1;d<_ ELө kg%?{KIJC:H890xnKDW|Q@zYi[Ŏ/;~z-lem Y(Ht84{7nljtkOc Y-*߅РFqwe!jݎ%8ca}2c}԰,U[>|'J{=0,+{ҍ[+d^o[hX{1 &NLmѤcRN&XMeJbp,ᱩ,"O cqvDM!mi?/=YM(ZPmDf[!3PݒJ3JʎEgޚ&"R8TA<`"c9[vsW.m2<>qLGİX\>~n3PeBx7uC< uS[ەE&> )^֗t!̷ +ibv90wv,ǒu948ZUb)è \ZEo W Y?_(4e@> 7 LC&e􁽗_1M_$P-0 Х[|-?ҿ?uO?\kj7,ջÉuJ 3[^]&'".=.!OB tDMzv蠁JxO.;EcM#bD! :gkZ*qLl+k+SkŌFRh?rgZLI5-3x] C.gV!;u`Lk=t쥗RTy[Ml,eeƻAϝpQۏ[vSsTεء{s @rijC^\thyzmv$lf,) ɱ_fj V LLbN&cagRЇO1@pLnjɔ BEQ&VBqKȐ6}\ Jʥ *@Uy/ "Csvv/vL8ȹ[OchA>gcx$d6Q*janI /pd ˪;(~ ^l>6#$0Ɣԃ j]P%0*;n5XN&J5pYNn zsk/Չe6NuNVdq*Qrp_]G-%wA<z7,-^($I%}{±q`Ls*QGܫ8LKZ|jǧI'姫n,*bH)_o8:_9CwU*7Y-j " -mH=z$TCj3fG61IFz?]|ͽWr"QS(!W 7H4%#Q~iX&~ҝ/-^zڭ/FS6)OI\eeM?&D>w]Lrޚ`g54ڑR56AO:g,>e?I1Bl놿}]佗@Nt=7og%2?7 *pHw->NT1r†>S%ՒVN{+`nH~G3A1Lc3ك?- ,MY[S"؋EwMrFF`g6FhJ_+{/el1FWjU,[܇s$1#gkƋgLIkP:BHrbd'>c" ztƏrMl C_ѭB(0sB_`nihٝJsʚt,gxԑ!T)ʂFݳ.1fADo50[Ů xj rdϹWj^gY @aK<;nbp#b(;J{a@MZvn"&qC!q`z],1)aޟUG#vth3]!l'_hp<Ѭ_\"y} d ƀXG&\F7CNx>YqhJThǸ 93X#t"ŖʻXQͭ&P@Iz L/Q̹ .bБ pv} W3F>%[(oF!PaSH=q74M< +mLN<$υ#nGBdL_e?15 ^Hغ4#KA/ds;CS#I4PYL @7;x!NfulQ2w%z?_|P] 2%,5 ;vA =tB0|[ 4TB-KKUoRP2$nqqͪ]af>)*!Q\2hz lhTJ(p]n%,D$R`žl?+4ryd3by#㾕)HǪ?xv K3ADu)qw %+ LU57/ ?`j$M%M U q9cœEرvdUs9QB9oA?ݜN-vߌ`h]=߃P_/tb7 .HXg8_J3'u"y,LǤcs`DYStnrrIl#vm8K6hz:SusA^9jn?b$ Cn0]ͺDB\@5R?OJeKZZ n*ZgLC{RMcLFkoёu+;/8\w@piEұK52, ]̌GWq;֋@8ب+3 ?ՄU$!y8,^q0״`R2gQ#@Ӊ?7b9@t {Ǚ X. sbrPc+GF4DA%TPK uka%6φ1 RQ.PW@&83R/w ]}XS|`AC~@&M&EK`vu]\nAdh2LMF!Ȳ0g~`R;$,[ r9 ?v8~qGje݅U*Ť5LB%ssTmɛ VtMCZeu5IJGcꐫkJvK (a%;.WrJN2,,#Q5J@w)FQB]K>XފC6IBSAPHBlDKVh eqXRP mM~6$!r.Ac6Mb+e9T6CTe{}`߈ $ہL]0 ~HfI+|hY֙];zL5Ts~\<\:uZ>zܘr+A!/mG?zE~b ~U7(4Pr;+޵^E1^0C)/(|eg08y"nb}wnQ~*:R;6?>޻Em }Fe2! *D_k}ȿ JɬĖ&ZI 5q>V~w3&1ގCB#E.p>o*ޯI:]dr3qIUï>{IXdoc녓 <޺ O> 3`'m.ڃ1D8?(i@/X l[K+Y|io9㻴C~"7ZA15 İг#?:=W /U =~^TGr5P`oDk~l|v J)S>Sn)&قT^G^Vė֧FEW6N íXMܓGM [~yKfek7=guwFEd_3g ZO69?=o85BM-%'?~b4wQy7u@EO<;Wזhnia3-%dԱ7`R,ݟ'\Y4auA䍣8L0[H.>q7S$q,m>]ڌWŌe !͆2z'tl a5&ߟ:2ee[O^9<"luRc$vLs?81+}|ɷZ, 0xs4w'vRe}Wbz6Q +A" ׭J<u8>E'[%<~pX'7Tځ}'lƦ&S_tbH_L;:[tڨKKǃeQ*`P׏}6+N h(/*[L2'~L1EsI,liĆ>H/G?gYkcHLjlʆ% cO˔ǗphîMwjqUj܀1Rt 7'c)(! 2ҞmHBQ⵴mMqS+zC9HWp+@ ]BMRN3Qsd(͆2hR|ǿ95Ѻ6M o8CI&Q&RU;Aqaq i!T[(bfL|@},Zrс1x k.ߡJKcݓ]eq?_V\g]};$0dy,RK[= s.4n]Vq=Wl tE(-ճ-I$BϻPFF$nm&~V# oXP*"oEyZ~P 3K}r_&2x3mnGꨠO,8pӈ I wn=aRӆ%.^>N lJ1-r89a廩\Yuʜ/6@샫fOb3'A*{)@rY{OOb[ 1 U&/Q-O71ޱX!)]+RBx#&6&YD!9φݳV&u`tyjFы/O=.yb ݥuDf+k%U6Y}Y#_~ݶ:[`y)rhmTI"S{SSADU>4I j,w:a_oБlmPN(0(gj鐅H%a <#ӭdJKv߽MBkZ^)n_e Y/sA5Ֆ}}94Z,ѧAGkzfxku*SijHMs+\7PnGRf6X V-}.?Dps;+kg%Iq;Ľ٨]>_څ Tb ʜCET`+ch2%~YRΓŢ Cd%&\m sc!&=̞qq)8Wy })M- /m!Iki*^Bi8  ĚIzۑAmaOOO(D Vr GiH_[*$glXB7X~L)aD%N?3ƨ4Vk~/^7)ʙ*UW BjU@:w-&i146`+Q mKs:(b-F ?НIe@$ V)hҘc݋K2}Z7DOȾO8zeprc+|$o*DGlH,"UZ BR<ľ*s"";q -MZE_Ҍܾh5Е;N)0gg bՋ=:X=gƭ ,?JT>0AU)hw+mVtTp?ʼnΗɒ$uō!@*7t[,ן2Fn@.;˻v:ip}ʠ9Lb¿<$O[XRi1ic?ةA%\.L[qx$geuwQdźKT-zpQCRL!bL.3[Hͱ,L_5>[,ָ=9&>Vgr[nQؔU"+wXyg@d.ۓ?2s\ ndR`UL! : wC $c;}yV4vwGw5-Oeo!{S4 sgW\'j|!me!9=$7=&N?P/я 43>W'20d[;Tp4 ( +{9Rrx"K`Wx91;$N4X\ >)[r߈t9S;l`:MĬKX((UTOnbe;q, -J~Bq/?c !|M=[s*=4% &ёiN ;,8HuXoAR@S& N1P̅V+(csUꉄıAlI%]t$왯vbb:7ݨ3d%zN:8Yקs)\҇ntZ8cz11~HJcc☍R0P+ęХ@@+bq}N"!l'4һ=A/4AKCC?y15A(= ;[hYiK6v CDM,fImB<HQDM +?ņyw(M+ɶ*8mZlS:/Wq8}z qcxd|pR9 fǖolfg$).@Y4<~~l+'3ܠ) & >q1]۔ڟz`* ꃨόAUх'`|U aB^LI#t1З\bȣ .0 ?6X _a(؝{uXN0lh)*15> x8 ^F Y) &ZTX; < Fl{~Bb"Z6,+wW!t]#'|\m"TN -ڵ8)?b!]k.%Fc0|k44tvN\9P^GqgCD0?Qn_" U*\[F֨os$"pKn%ȘpswS'M#81@ \=xHJ40dmy' 3hLls@Q D[z.eti]:/mwK?,|QTjM/L{if}$\hJɧ}Yݥ~- oH8(NIvrAQXƸ5{RP }v"A޴qQ `cwvhX8Zʒ)'ZX;V9ιtVς/[L]CA&lSw/J[.L˭*W q2pz51³M-Iy>|IVFؔn!TW`{Bky{lJ@D|bo 4S60 nj(ۖ&jil@=F^S`u/A\q>C2wr#&eH!Lk3=;ݶF4@&\}Za#C)l7~vJ8JЗC-@Jy*G~\1Ӝ{Cuus;%bS }JͰ<6(s(!'* "[PFu*|I |e$YWm.Y9fen{:ˣ:m'RSI| &4P);0.%@zRQuOѤ]ܕ_DkzRoPceWg ӫn*.cad25*̝ 3yN$޳br礢R'M#1=\;x皡Ƽ~*J %]{ [~F pq=NhD*GACj(Sx, )u91+ck ,d(67+Y[@u$}Pfi]d4 u5Tz^|8EML kKݷUρJ.G4dK{(ZRYbyzֈIKژc^Dkt`=Nov ' qx,1jޗHPG8Ӹސ:kwnI BN◅vdR<(WTiMBP KjpYSsOL=Fd [0*n"sh ] C&e7Jro},JOOѻ 8[&;hMtcNewKoP{NXQa05V"{4XwuzG@&d݆@?,> l'mQ>Q|⪅2$ 2u,e?S $kW_j>ͦ9j']7*CC.TF$aUo3Ѱ ʅ`pEZ`F-htos裂 ڐ~K;ʻYdun5$(JمG3Hk|􍃊OoB:,;ο\<}Pd[G*0D(Pwe GE%.DS_$~ H9ʑǖɀ@g(w[V_3 #ndotDxd=qgQy9}QɥkAyʘIȉ04,9zL[G> l''Jtk<ZcJ@uٴA:G^~~2͢uC҃Onw))Rp?oԇ!0,j=5crd++yO"]pVm{*[L wq9DOyy ͌IᏟ ]KQigѮ0#H"6c5VwX]i#<#럈*w"d92u}nӱRW|䕮 '5or4xCtM|~G<8㳂~'qSakG!ހ4&*`# up*ˋ@aȏSvcU%Yt6{قGِDHǚa;.D8 1᪓`{-c udfM+cJ}'֚ 5>zG)w jN=0Dx.>r`$LN٭? L:Yg'݁M?xb,Kqc 6g|;]$u9i/ q+u:py2?u)WhlM+raRto"b)[ QUoˆ5yo9i*Nt:rNgi)5-]V!牁Է;cV!FHؘYy}=0GK)5ru!1OEZ!!-EbN?;o{MZbsywV/Ydheʨ `Íkb3Zn_m !ݘx_izպyK| ׮E/9OЋlʒ:-Vnr7lӆtϊIV_yT8E5mݹFc3څ ܪC }yI>K2F53Д\u -_n0U)=Q|@deNPT4I)&lKKq&8bhaV0Ѣԙw0U@)k YqrN} ☺(tS7ݙCT%6ݿcAvՋ8e}9:<|JM2?ly2>F|{~>|ؼjUHY[ !m Z={_$zyOj&jX uw- [<^@.I&lJeHa۫<СvJCpectg'^*' <.zu7 C6.2l fuð {~[(fmԷ=qB 0& +ܷR7ҁxlsfazUU&(1A1(?2EέDJdE_t6@%t;6*C',9 J ZU3탡6B5 VH|{:`W@W2`xͱZ(Ǩ*O]0o1܆ {%*ɾ2TVWpYnp; j檻Zw/+wH.I ]Ct|b`2.8"#@/)Q+=.LK-w"+huQ1r R9RMn͢ƵXqX0ZŔh#de^ʟg SZNF\Y9iuk~/'t6XW HiwW^Ђ+%n$䩷9ݘQQ6K&~z"4AV-ZǔOԛ}dhU<6lJgRM@9GN7 D-K{H"a籍ăʼn# lZڰ5eeq5JצCE*c""d~Ewtւ]5eϬfV+-dv$Ueѿ$U5pX%YVUQҩ;QEj%)+K>1 osV ˓a#xZdLJ_s.hLceє/mW]r/4~x ]IM{焻gJ;#,, 8 Aٍrwi|2ۊo>zQUM0m+Oݼx;N{=qފ&2/?6!=D;zwc6?zAq2"팙u?~h+}z \eK W$1._:dG"+] Vq.ծOO#h]7A5)E) Y`>-*'h{2:7cweC!|Eb@-!ou~rvӹp1S#qlH3'4Kzr.4,ˣ; tbŮZN^a9Bi7H5zwT)%P8`P_l;HZHKܰɕxQ o9G,zz LOFVw.]S_&ĺ" ͱ/$>RgP;7*yO*@# ? J^uNYc6⎏'P#J VOFJNHqm׸gs+*i]}W8RS܀8s-rmqE/M/OP식*%.,Ə C^8dĒ%͚lP#NT9Eo;zFH 4* sc"3RN~]W L!qm 3-:е情r)fz9^0rńW&S\H<OYȰd O 4's~(I9 35gP,Sơ|MV+J3S\lIubd/43L`%yT>KRzP#/0K BahjYJ &=aWN|zׄ=n9~$PY1R1G붦%ck@+ F{'}1%WP=VRoj{w3B7s*/ς5% :vIgcϗ7vY2l.VcJqːit *G64Eėl9AE٧VAQXڹ vά+1E4~/ol&uܗ*Oэx*dIelQ'HZ*3Tem'c<0x3vx.u \LքGgNUL~.` x!>7c%K~^PѝToަǂoenNEK(u qHtølS7&qZa6Or[qTG>9m> ,/VR ˮW-I<&3h wcVq}2 ]A|A_18p3J"qnpwmWfJrWސk d ߜxmpDE2F?q\pQӷE+TLM!oP38 B.R=bmTN;0$I%v9:Tzsa&g,Rǣ.6v:}0yo9^ !&ɓMXt/tCz~L l VZޠM:G=5L4)ބpD8cNѠv#R0 :7m6+ = sCS:h/DU%|2Ҋ6:󑬢M-tI'+ P|KRUlU,oNi7/}޽y&Jj˖UV!3Ӽ}G98_1QOڤ_ƨRC"5$5]WW,B^`&&%⻎0J)*uP|[ E%B/‚joleZD(ĩ_7*4x-S5 ̃L x8I_1(ZgٿJdxNi>pHF6>@ڣ 3;$rOo:[*jzw豂I[]}/1{Ht t߭`Sj;C{}2ngZS|l9[=m$yh G~7=jYƴ @ESɦ<1Y!DUBO P!3wF- utBe~r\K.7hcBmƆem~Mf}_|,h[~Ѡ MlEo1Gvsӑռ?+֠c8n(q˚5G^$i/'tʞELZhy?=HUgǪ+#F:gt- mZeғ'LMxcB*K btqH-/ԟWrڕy=A[#yC.a zcyMHIȓ_X#c@}s_Up0G3pXwr\aR  Q_\Aq6xu.F& r3؞4!3lXRkW[?e7L? -5L i (`{iB"F@E¼G#6U,ކO[~۠ qwQm/vI~1<*0j3@\&o2ὦT'c`ذͮfΆ;"{5KaLczi_h-ѭ}9X%] 5z:9P,>l P#lR@A$9q*z:eQ;FѠOtNR-`@԰iCr쵡 "v"Ϸ H/ GAyĉ?|4] *bogIxol> 7sʄ*L^95ݬR>d'72& ütmtP*d\k DIy'&) >~Oeƈ'| Kzyz(_fwj}mAIOsTx 6W7Jbg io+Oy0rLCމhq:d K g?)ھNUSbT[:qoKԦH> ji6);A4۬gWqJ*xŎ1_yر!ܟ3bOx3yn]fllC#TZ'Ū#H3m܏cT->R>2g(b"]o&_yl\ɰn|/9 K\QVI!Rr{τ"RDJA X x!:PJx `=yłAi%FK3;'|UZ323ӿ~rB7qv։m|vїЯUC\@ӿD<<8^+<>B;:O7ʹv8j~.3>R8Z994}I'Dtt\|If0,7 [Q‰##o{Dڠ"vN `/7!z࢖f (aZZx/Omc Nbq#T`9V)ljѧ{/k=j nY"qK$MJ5/2IhN?5™km60<,zXs1܌mSW>t*C['KA],.G4H+?d iiCa!JN!jZ, "ߕut{}dk*D%*~iNW*B$݆s=E8}b0w~c7ay$ V׬jc}Q"\!'QaӓE`bz&_ \QedJ.a'VTCO{ԅzUѐ 7qD0UMvtb╈XiT }-*5ЊH?"DJt!)_f-}";pՃOHUߖ5 i6Ʀ1NTfe+쇃^Z;]4;׹.r1<1Ig{js,ɉ܃Q+a`sW$]i+}tט,,[* A}MloE3*R̖T†8enn-5W<'%@J-{7 0Y+F0[Ͽ#~/)LX4::') sa8i˻,`euk2y UfLI99Eȋ/ltAv\R*K;A/Kpf'bP:⧬v'm2};՚uk(rqb}q l-)'|8 >) ;3vk*M(.5b2e&5qs 5!K0ZqA:\/m:N&n; SD źԘc0f΂B>L #TW3vq9h6fãd32 V >U}>QCEZLC L#,%DZ RhuaI<glXl/)";\N''ٝMH.eMR\4-&͒k`8"2풀n4v7:U[[&Y@z I66 } DB}3lc0ʮ(olf黳|l@7N.m}L% 3\z\aS}7s+_h qA*|AKYpC84t,;Mf@>՞&W t /;a\+q%_H7Ra[-d2\DJ R4VoxLP~Ԅv38oߚ.)Rؔ%G5ZM&넬-OP'\/k^Q>E`RρhoewMgYI)uP[0J^p*F^P阢׻8@[3JUc3`*5UJև$[1]A9/SBFD7p)W,ZPLL&"EJ/NNlˮ _\0{Ş?닚q W*_83(ᖇօTyGMޟj"8ߏh\MH7W3mbmZe,^{2 ĐwuOVxnłU/tv1!'6$ ucJ~iGym ӁĜ(aِW7؟o,RJ14qY9ȭ^ "NRWo!~Z}#VX52jUj" cwO{erRrnMO_k&OTڛ+ oo-> uD( %6SCWJrc#jgOiTG&=)vgXWr{l]qt.en/дm,"^MK2PyQكĄ!E^hnL{n|g)tDOސ('r xsCɶGד(B tښQpsYXT1$hRU4E 7 !g.*}V3@' Wus[@5;Nmyt?_P.hőa_0'#ܢTFq5,1kO ^aar>XB_S4 =Q\ID}ee9{/oWn+8v%fXHjITh懧c{^?H[P w0wЎ[K|Rf + ȊDb8_Yaݒi8Jfad/H t{`,%_b_6X]xal@p8oraf9բa9){{lcᄢF'7Ss,bsVɤeŔL,ҽ&h:Ⱥs̡eY)~N3h?;}DBMq!ڊM=?'B?~вVSKR\6a{cyͿ='*P1ec[\9d!'xs<;T._Y>8Nk(\%9KPhl9wTi[\9v1prj077s(,7#Y(ˣ|)5%3uFy: fNZ BSo`{##Q)lzέ <J^&wA۪c`?-մÍ7vKƞޠ{o na id9&'l\·fOiUɹ@ZLUCܫ+ 8x*kDퟒ4fF @{-~ ~$"5Qv6a*+!f ُU5 x^!@0]cq,X (t3z"lo Lov(;Q,Hp֓Q5Zorv[`M$tYrQQ,|3&oF1KS!˕.Y8p(u7}]_}JG_̍X `ʍ$6-KA!vMC|b2u*ΥȪlJTi>Sx.ܜ?C?a4Vi_5֣,y&(VF+Wz +{ ݌-hjfن,1uM/JVzw~&,!k᜚H(K 8xW=UuA6*Mj}\"3]SBx橲9Q/veQOYp8.Na!mLIl bҥ/ݕsMcE j 6ww&oAWr1\藵aK!D`urjW_2hbuC8PE_Ʀ$ `1_JȨߴ|kpdarm,\] <7Ahn-5L{w 143N^V +jy+v+ǘqgZ}%">sMzYgmU; >CoHH: 6j"keĄ} ֪1it@* |V-SՕ |R胾jZ >Ļ D/6ʞ]a 3/}md^@0UP_׾â:yLEB#y\E"&S-N4nU7t. ӋCٻr^aD7|V0SwjK5/vϹAu @+Ӓ_ o|=}{Ya(2S$j:͒DZAsL1qMր\h myRwTM4I} _.}B^ ]dmD,it eTKb>8Y) `U&xE4Uv\{{ f7u2$k]8Tq(?S e`iK>R>2$ vR_9ѷW6FDkdOvv"gAl4*EY}Ml)xN[LOȜyUPL$%tW 4Ɂ{\G0M)]sO=& kX^ Q#W&:W+`0U`F Bۻ  Pq8OJebxYhaV*p송w$2nٔӇ6|ϯ&pZSjEc"c̛E^;.{4G#k 4TK-[+:ƊVZmƤ&4th)8W*q9p=!H'Y3#%}>%-YoUI 'v9~!rw/ ]} r9ɝ+N62#}pN`*/3,TD>Ϛ}zyWfO꯰p5]l <}\Kjww t-<'yY rk*"Eցa?y9.uinλ2Qs4_`y{*>CTW_txOJtbkmTU?ce0mr5"6^b\4yI9-;k/+Jj=d?e=7PtBR{ i']81xƇ2ܷ8ȠxNB>Cf v9^.l}hӾ?z~ŏyB( 皺xfz14^m1q)*2B?uT\C ^nVC%~(FlzflbQP,Q=*@8jT7v‰>Zq 6]4$FoWe'Y0H^T Uy%p*1 ``>JM~BT&s73OHN#wQÃͣ`2ʖN-5G3".+X- !`I#r#3x4 l/_>E&i;C}Y\o./R0$Q+h9E{ RR$ &@ZVܑcԂ=ǔP_jgLH{F[ǝBV;$t" LK6GND![2in,SToL*3 ˢkBI_YsuJ L}?5c,Ӿ^[Pm?+'v J#Go8Z=gMa/]|~ۀ7.FUv_opKϑK7-Lj:nM SOIw H9_@b[E-M|K}[XӰCa]Z~l藞wnj D({3M ]Y ``y"(V!⏭y^+0ݞ*L|Q_mxL3S|`]:e1~ U{!S!$oP zTL:MY籖LDikĝ iEK˩w%RӀmqcI3Tˢ>Q L(r3CҷAXwyZHog4a`D*,4rh6f}ly^Ƨ뙊Kㅹy:U'ԩh3 34 Bbե^)$B"Oorʉm9H1\b&2 e0%޶*J+ٟJ[ Łp w SƊ-b(.u'`F \"q-uʽ"ƶlބpk- έR JYmͰژM+/aM=٨lq܃`5O|0C ΁ H]Wm&E@K.X @ ǭvi S-`sa݃;@yXa^+A~-~>_4r$&S{]&IVrd# H&zܧJzNAvlA, 'g `^f{D࿂G5}4&{ޔ@!5@5܂@ZJاXf.JJJkߟFh/DxԷ҃ҨI~mЅO:a斢k!4!Zh5Osѣ mS>Kp2p\\$BY{PfԱ9M/g˝A~Z9q9 T]\؁3Vq')"f`v|"z!vmJZJv]wB\L?,,I sc; %b8MeC2M0 ȰрoF맡?,Fߴ@5r9#oE.;yTp.hD! hl[W XsPS CXV\<3XD7"ׯUt*r1|v "V[6IUH:V\fY7Ro *+Ê&ϛf3 TM1~'XEw}MTok;`-?nˇ{YJi'Fvps'A:`B&5'7EG9Z$63r\EZ`18}G+Me7HDKNwh\v@xVx%h-J0~*CaL5 _Y ZwsŸiMXvr rB;{NAe tDeOs0 p<nAU{=4|LjiL{ | YZ